KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_00661Help
Entry
TBMG_00661        CDS       T00940                                 

Definition
(GenBank) sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00010  Glycolysis / Gluconeogenesis
mtb00052  Galactose metabolism
mtb00500  Starch and sucrose metabolism
mtb00520  Amino sugar and nucleotide sugar metabolism
mtb00521  Streptomycin biosynthesis
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
mtb01200  Carbon metabolism
Module
mtb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBMG_00661
   00052 Galactose metabolism
    TBMG_00661
   00500 Starch and sucrose metabolism
    TBMG_00661
   00520 Amino sugar and nucleotide sugar metabolism
    TBMG_00661
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TBMG_00661
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TBMG_00661
Enzymes [BR:mtb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TBMG_00661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACT23696
Position
747822..748730
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAVAEMIADALGVAGGAV
GGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPVRLGGDGVCMALGEHWL
GAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVVVDPDGSPCPCGGRGCVE
TIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRAFRRGAAALAAMIASVGAV
CDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAA
IA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctttgcctcgacatcggcggcaccaagatcgccgcgggcctggccgacccg
gccggcacgttggtgcacaccgcccaacgtcccaccccggcgtatggcggagccgaacag
gtctgggccgcggtcgccgagatgatcgccgacgcgctcggcgtggcggggggcgcggtc
ggtggtgtggggatcgcctcggccggtcctatcgacctacacagcggccgcgtcagcccg
atcaacatcggatcctggggcggctttccgctgcgggatcgggtcgccgccgcggtcccg
ggggttccggtgcggctggggggtgacggggtgtgcatggcgctcggcgagcactggctg
ggagccggacggggtgcgcgctttctgttgggtttggtggtgtccaccggggtgggcggc
gggttggtgctcgacggcgccccctgtctcggccgcaccggcaacgccggtcacgtcggc
cacgtggtggtggatccggatggctcgccgtgcccgtgcggggggcgtggctgtgtggag
accatcgcgtccggcccgtcgctggcgcgctgggcgcgggccaacggctggtccgcgccg
cccggggccggcgccaaagagctggccgaggcggctggggccggagacccggtggcgctg
cgggccttccgccgcggcgccgcggcgctggccgcgatgatcgcctcggtgggcgccgtg
tgcgacttggatctcgccgtcatcggcggcggcgtggccaagtcgggtcgcctgctgttc
gagccgttacgtgcggcgctagccgaccacgcccggctggactttctggccggcctgcgg
gtggtgcctgccgagctgggcggcgccgccggcctggtgggtgcggccaggctcgcggcc
atcgcataa

DBGET integrated database retrieval system