KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_01952Help
Entry
TBMG_01952        CDS       T00940                                 

Definition
(GenBank) phosphofructokinase pfkB
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00010  Glycolysis / Gluconeogenesis
mtb00030  Pentose phosphate pathway
mtb00051  Fructose and mannose metabolism
mtb00052  Galactose metabolism
mtb00680  Methane metabolism
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
mtb01200  Carbon metabolism
mtb01230  Biosynthesis of amino acids
Module
mtb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBMG_01952
   00030 Pentose phosphate pathway
    TBMG_01952
   00051 Fructose and mannose metabolism
    TBMG_01952
   00052 Galactose metabolism
    TBMG_01952
  Energy metabolism
   00680 Methane metabolism
    TBMG_01952
Enzymes [BR:mtb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TBMG_01952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACT25020
Position
2140290..2141309
Genome map
AA seq 339 aa AA seqDB search
MTEPAAWDEGKPRIITLTMNPALDITTSVDVVRPTEKMRCGAPRYDPGGGGINVARIVHV
LGGCSTALFPAGGSTGSLLMALLGDAGVPFRVIPIAASTRESFTVNESRTAKQYRFVLPG
PSLTVAEQEQCLDELRGAAASAAFVVASGSLPPGVAADYYQRVADICRRSSTPLILDTSG
GGLQHISSGVFLLKASVRELRECVGSELLTEPEQLAAAHELIDRGRAEVVVVSLGSQGAL
LATRHASHRFSSIPMTAVSGVGAGDAMVAAITVGLSRGWSLIKSVRLGNAAGAAMLLTPG
TAACNRDDVERFFELAAEPTEVGQDQYVWHPIVNPEASP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccagcggcgtgggacgaaggcaagccgcgaatcatcactttgaccatgaac
cccgccttggacatcacgacgagcgtcgacgtggtgcgcccgaccgagaaaatgcgttgt
ggcgcacctcgctacgatcccggcggcggcggtatcaatgtcgcccgcattgtgcatgtc
ctcggcggttgctcgacagcactgttcccggccggcgggtcgaccgggagcctgctgatg
gcgctgctcggtgatgcgggagtgccatttcgcgtcattccgatcgcggcctcgacgcgg
gagagcttcacggtcaacgagtccaggaccgccaagcagtatcgtttcgtgcttccgggg
ccgtcgctgaccgtcgcggagcaggagcaatgcctcgacgaactgcgcggtgcggcggct
tcggccgcctttgtggtggccagtggcagcctgccgccaggtgtggctgccgactactat
cagcgggttgccgacatctgccgccgatcgagcactccgctgatcctggatacatctggt
ggcgggttgcagcacatttcgtccggggtgtttcttctcaaggcgagcgtgcgggaactg
cgcgagtgcgtcggatccgaactgctgaccgagcccgaacaactggccgccgcacacgaa
ctcattgaccgtgggcgcgccgaggtcgtggtggtctcgcttggatctcagggcgcgcta
ttggccacacgacatgcgagccatcgattttcgtcgattccgatgaccgcggttagcggt
gtcggcgccggcgacgcgatggtggccgcgattaccgtgggcctcagccgtggctggtcg
ctcatcaagtccgttcgcttgggaaacgcggcaggtgcagccatgctgctgacgccaggc
accgcggcctgcaatcgcgacgatgtggagaggttcttcgagctggcggccgaacccacc
gaagtcgggcaggatcaatacgtttggcacccgatcgttaacccggaagcctcgccatga

DBGET integrated database retrieval system