KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02544Help
Entry
TBMG_02544        CDS       T00940                                 

Definition
(GenBank) triosephosphate isomerase tpi
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00010  Glycolysis / Gluconeogenesis
mtb00051  Fructose and mannose metabolism
mtb00562  Inositol phosphate metabolism
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
mtb01200  Carbon metabolism
mtb01230  Biosynthesis of amino acids
Module
mtb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtb_M00002  Glycolysis, core module involving three-carbon compounds
mtb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBMG_02544
   00051 Fructose and mannose metabolism
    TBMG_02544
   00562 Inositol phosphate metabolism
    TBMG_02544
Enzymes [BR:mtb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TBMG_02544
Exosome [BR:mtb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TBMG_02544
  Exosomal proteins of bladder cancer cells
   TBMG_02544
  Exosomal proteins of melanoma cells
   TBMG_02544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACT25619
Structure
PDB: 

Position
complement(2797335..2798120)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEHFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggtgcctatacg
ggtgacgtcagcggcgcctttctggccaagttggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcttgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcatcgcctacgaaccggtctgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggatgacgtcgatggtggcctggtcggcggg
gcgtcgctggacggggagcatttcgcgacgctggccgcgattgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system