KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02860Help
Entry
TBMG_02860        CDS       T00940                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating gnd2
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00030  Pentose phosphate pathway
mtb00480  Glutathione metabolism
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
mtb01200  Carbon metabolism
Module
mtb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mtb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TBMG_02860
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TBMG_02860
Enzymes [BR:mtb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     TBMG_02860
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     TBMG_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD F420_oxidored 2-Hacid_dh_C TrkA_N 3HCDH_N GFO_IDH_MocA UDPG_MGDP_dh_N Shikimate_DH Sacchrp_dh_NADP NAD_binding_11 Rossmann-like PDH
Motif
Other DBs
NCBI-ProteinID: ACT25943
Position
complement(3166026..3167048)
Genome map
AA seq 340 aa AA seqDB search
MQLGMIGLGRMGANIVRRLAKGGHDCVVYDHDPDAVKAMAGEDRTTGVASLRELSQRLSA
PRVVWVMVPAGNITTAVIEELANTLEAGDIVIDGGNTYYRDDLRHEKLLFKKGIHLLDCG
TSGGVWGRERGYCLMIGGDGDAFARAEPIFATVAPGVAAAPRTPGRDGEVAPSEQGYLHC
GPCGSGHFVKMVHNGIEYGMMASLAEGLNILRNADVGTRVQHGDAETAPLPNPECYQYDF
DIPEVAEVWRRGSVIGSWLLDLTAIALRESPDLAEFSGRVSDSGEGRWTAIAAIDEGVPA
PVLTTALQSRFASRDLDDFANKALSAMRKQFGGHAEKPAN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaggaatgatcggtctgggccggatgggtgcgaatatcgtccgccgcttggcc
aaaggtggacacgactgcgtggtctacgaccacgaccccgacgcggtcaaggcgatggcc
ggggaggaccggaccaccggggtggcctcgttgcgtgagttgtctcagcggctctccgcc
ccgcgagttgtctgggtgatggtgcccgcggggaacatcaccaccgcggtgatcgaagag
ctggccaacacgctcgaggccggcgacattgtgatcgacggtggcaacacctattatcgc
gacgatctgcggcacgaaaagctgttgttcaagaagggaattcacctactcgactgtggc
accagcggcggtgtgtggggtcgggaacgtggctactgcctgatgatcggcggggatggc
gacgcgttcgcgcgcgcggagccgatcttcgccaccgtcgcgccgggggtggcggccgcc
ccgcgcaccccgggccgagacggtgaggtcgcgccatcggaacaaggctatttgcattgt
gggccttgcggttcgggtcacttcgtgaagatggtccacaacggcatcgaatacgggatg
atggcctccttggcggagggattgaacatcctgcgcaatgccgacgtcggcacccgcgtg
caacacggtgacgccgaaaccgcgccgctgccgaatcccgagtgctaccagtacgacttc
gacatcccggaggtcgccgaggtatggcggcggggcagcgtgatcggctcctggctgctg
gatttgaccgcgatcgcgctgcgcgaatcacctgacctagcggaattctccggacgggtc
tccgactctggcgagggccggtggaccgccatcgcggcgatcgacgagggcgtgcccgcg
ccggtgctgaccaccgcgctgcagtcccgcttcgcctcgcgtgacctcgacgacttcgcc
aacaaggcgctgtcggcgatgcgcaagcagttcggcggacacgccgagaaaccggctaac
taa

DBGET integrated database retrieval system