KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_03374Help
Entry
TBMG_03374        CDS       T00940                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase moaB3
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00790  Folate biosynthesis
mtb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TBMG_03374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtb04147]
    TBMG_03374
Enzymes [BR:mtb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     TBMG_03374
Exosome [BR:mtb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBMG_03374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ACT26476
Position
complement(3708302..3708676)
Genome map
AA seq 124 aa AA seqDB search
MAHGNVSRCEESSLHDVCCGRLSALTDRELSERLTALPGWELVDGKLRHTFGFGSFDQSM
KFVAKIAAIADKFNHHPDICVHNKRSVRLTCWTRQMHCLTRVDFDLAEAFSAVHDEQCSQ
QVAR
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcacacggcaacgtcagtcgatgtgaggagtcaagccttcacgacgtgtgctgcggc
aggctgtcggctctcaccgacagggagctgtccgagaggttgacggcactgcccgggtgg
gagctcgtcgatggaaagctccgccacacatttgggtttgggagcttcgatcaatccatg
aaatttgtggcgaagatcgccgccatcgccgacaaattcaatcatcaccccgatatctgt
gtccataacaagcggtcggtgcggttgacttgttggacgcgccagatgcactgtttgact
cgcgtcgacttcgacctcgccgaggctttcagcgcagtgcacgatgagcaatgcagccag
caggtggcacggtga

DBGET integrated database retrieval system