KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_03585Help
Entry
TBMG_03585        CDS       T00940                                 

Definition
(GenBank) acetyl-CoA acetyltransferase fadA5
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00071  Fatty acid degradation
mtb00072  Synthesis and degradation of ketone bodies
mtb00280  Valine, leucine and isoleucine degradation
mtb00310  Lysine degradation
mtb00362  Benzoate degradation
mtb00380  Tryptophan metabolism
mtb00620  Pyruvate metabolism
mtb00630  Glyoxylate and dicarboxylate metabolism
mtb00640  Propanoate metabolism
mtb00650  Butanoate metabolism
mtb00900  Terpenoid backbone biosynthesis
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
mtb01200  Carbon metabolism
mtb01212  Fatty acid metabolism
mtb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBMG_03585
   00630 Glyoxylate and dicarboxylate metabolism
    TBMG_03585
   00640 Propanoate metabolism
    TBMG_03585
   00650 Butanoate metabolism
    TBMG_03585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TBMG_03585
   00072 Synthesis and degradation of ketone bodies
    TBMG_03585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBMG_03585
   00310 Lysine degradation
    TBMG_03585
   00380 Tryptophan metabolism
    TBMG_03585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TBMG_03585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBMG_03585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TBMG_03585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtb04147]
    TBMG_03585
Enzymes [BR:mtb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TBMG_03585
Exosome [BR:mtb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBMG_03585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACT26693
Structure
PDB: 

Position
3971030..3972205
Genome map
AA seq 391 aa AA seqDB search
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggttacccggtcatcgttgaagccacccgcagccccatcggcaaacgcaacggatgg
ctgtcggggctgcatgccaccgagttgttgggcgcggtgcaaaaggcggtggtcgacaag
gccggcatccagtccggccttcacgccggtgacgtcgaacaggtcatcggcggttgcgtg
acccagttcggggagcaatccaacaacatcagccgggtggcctggctgacggccggtttg
cccgaacacgtcggcgccaccaccgtcgactgccagtgcggcagcggccagcaggccaac
catctgattgccgggttgatcgcggccggtgccatcgatgtcggcatcgcctgcggcatc
gaggcgatgagccgggtcgggctgggcgccaacgccgggccggaccgctcgctgatccgc
gcgcagtcatgggatatcgacctgccgaaccagttcgaggccgccgagcggatcgccaag
cggcgcggcatcacccgcgaggacgtggatgtcttcgggctcgagtcgcagcgacgcgcg
cagcgggcctgggcggagggccgctttgaccgcgagatctcgccgatccaggcgccggtg
ctcgacgagcagaatcagcccaccggcgagcggcgcctggtctttcgcgaccagggcctg
cgcgagaccacgatggcggggctaggcgagctgaaaccggtgctcgagggcggcatccac
accgcgggcacgtcgtcgcagatctccgacggcgcggcagccgtgttgtggatggacgaa
gccgtggcacgtgcgcacggcctgaccccgcgggcccggatcgtcgcccaggcactcgtc
ggcgccgagccctactaccacctggacggcccggtgcagtccaccgcgaaggtgctggag
aaggccggcatgaagatcggcgacatcgacatcgtcgagatcaacgaggcgttcgcgtcc
gtggtgctgtcctgggcgcgggtgcacgagcccgacatggaccgggtcaacgtcaacggc
ggggcgatcgcgctggggcatccggtgggctgcaccggcagccggctgatcaccaccgcc
ctgcacgagctcgagcgcaccgaccagagcctcgcgctgatcaccatgtgcgccggcggg
gccctgtccaccggcaccatcatcgagcggatttaa

DBGET integrated database retrieval system