KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_03709Help
Entry
TBMG_03709        CDS       T00940                                 

Definition
(GenBank) acetyl-CoA synthetase acs
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00010  Glycolysis / Gluconeogenesis
mtb00620  Pyruvate metabolism
mtb00640  Propanoate metabolism
mtb00680  Methane metabolism
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
mtb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBMG_03709
   00620 Pyruvate metabolism
    TBMG_03709
   00640 Propanoate metabolism
    TBMG_03709
  Energy metabolism
   00680 Methane metabolism
    TBMG_03709
Enzymes [BR:mtb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TBMG_03709
Lipid biosynthesis proteins [BR:mtb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TBMG_03709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACT26816
Position
4094507..4096462
Genome map
AA seq 651 aa AA seqDB search
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWS
GAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAK
LLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVV
GSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDV
FWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTL
IRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGS
AMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSML
RGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEV
ESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIAR
PRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagtccacccccgaagtctcctcgtcatacccgccgccagcgcacttcgccgag
cacgcgaacgcccgcgccgagctttaccgcgaggccgaggaagaccggctggctttttgg
gccaagcaggccaaccgactgtcctggacgacgccgttcaccgaggtgttggactggtcg
ggggcgccgttcgccaagtggttcgtgggcggcgagctcaacgtcgcctacaactgtgtg
gatcgtcacgtcgaggccggccatggagatcgggtcgccatccactgggaaggcgagccg
gtcggcgaccggcgcacgctgacctattccgatctgcttgccgaggtatccaaagccgcg
aacgcgctcaccgacctcggtctggtggccggtgaccgcgtcgccatctacctgccgttg
atccctgaggccgtgatcgccatgctggcctgtgcccggctaggcatcatgcatagcgtt
gttttcggcgggttcaccgctgcggccttgcaggcccggatcgtcgacgcccaagccaag
ctgctgatcaccgcggacgggcagtttcggcgcggcaagccatcgcccctcaaggcggcc
gctgacgaggcccttgcagcgatccccgactgctcggtcgagcacgttctggtggtgcgg
cgcacgggaattgagatggcctggagcgagggccgcgacctgtggtggcaccatgtcgtc
ggctcagcttcaccggcacacaccccggagcctttcgattccgagcacccgctgttcctg
ctgtacacgtcaggcaccaccggcaagcccaaaggcattatgcacaccagcggcggctat
ctcactcagtgttgctacacgatgcgcaccattttcgatgtcaagccggacagcgacgtg
ttctggtgcaccgccgacatcggctgggtcaccggccacacctacggcgtctacggcccg
ctgtgcaacggagtcaccgaggttctctacgagggcacgccggatacccccgaccgacac
cggcatttccagatcatcgaaaaatacggcgtgacaatctattacaccgcccccaccctc
atccggatgtttatgaagtggggccgtgagatccccgacagccacgacctgtccagcctg
cggctgctggggtcggtcggcgaaccgatcaaccccgaggcttggcgttggtaccgcgat
gtcatcggcggcggacgcaccccgctggtagacacctggtggcagaccgagaccggctcc
gcgatgatctccccgctgcccggaatcgctgcggccaaaccgggttcagcgatgacgccg
ctgcccgggatctcggccaagatcgtcgacgatcacggtgatccgttgccaccgcacacc
gagggcgcccagcatgttaccgggtacctcgtcctagaccagccgtggccgtcgatgttg
cgcggcatctggggcgaccccgcgcggtattggcactcttactggtccaaattttccgac
aagggctactacttcgccggggacggcgctcgcatagaccccgacggcgcgatctgggta
ctaggccgcatcgacgacgtgatgaacgtgtccgggcaccggatctcgaccgccgaggtg
gaatcggcgctggtcgctcactctggcgtggccgaggcggcggtggtcggggttaccgac
gagaccacgacccaggccatctgtgcgttcgtcgtgctacgcgccaactacgccccccat
gaccgcacagccgaagagttgcgcaccgaagtggctcgagtgatctcgcccatcgcacgg
ccacgcgacgtccacgtagtgcccgaactacccaagactcgtagcggcaaaatcatgcgt
cgactgctgcgcgacgtcgcggaaaaccgtgagcttggcgacacgtcgacgctgctcgat
cccaccgtattcgacgcgatccgggccgccaagtag

DBGET integrated database retrieval system