KEGG   Mycobacterium tuberculosis CDC1551: MT0137
Entry
MT0137            CDS       T00053                                 

Symbol
fbpC
Name
(GenBank) esterase, putative, antigen 85-C
  KO
K18851  diacylglycerol O-acyltransferase / trehalose O-mycolyltransferase [EC:2.3.1.20 2.3.1.122]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00561  Glycerolipid metabolism
mtc00572  Arabinogalactan biosynthesis - Mycobacterium
mtc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    MT0137 (fbpC)
  09107 Glycan biosynthesis and metabolism
   00572 Arabinogalactan biosynthesis - Mycobacterium
    MT0137 (fbpC)
Enzymes [BR:mtc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     MT0137 (fbpC)
    2.3.1.122  trehalose O-mycolyltransferase
     MT0137 (fbpC)
SSDB
Motif
Pfam: Esterase
Other DBs
NCBI-ProteinID: AAK44361
UniProt: P9WQN8
Position
complement(156749..157789)
AA seq 346 aa
MGLVVAMTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPV
EYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIM
PVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGG
SALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKR
NDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGR
NGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
NT seq 1041 nt   +upstreamnt  +downstreamnt
ttgggattggtagtagctatgacgttcttcgaacaggtgcgaaggttgcggagcgcagcg
acaaccctgccgcgccggctggctatcgcggctatgggggctgtcctggtttacggtctg
gtcggtaccttcggcgggccggccaccgcgggcgcattctctaggcccggtcttccagtg
gaatatctgcaggtgccatccgcgtcgatgggccgcgacatcaaggtccagttccagggc
ggcggaccgcacgcggtctacctgctcgacggtctgcgggcccaggatgactacaacggc
tgggacatcaacaccccggccttcgaggagtactaccagtcagggttgtcggtgatcatg
cccgtgggcggccaatccagtttctacaccgactggtatcagccctcgcagagcaacggc
cagaactacacctacaagtgggagaccttccttaccagagagatgcccgcctggctacag
gccaacaagggcgtgtccccgacaggcaacgcggcggtgggtctttcgatgtcgggcggt
tccgcgctgatcctggccgcgtactacccgcagcagttcccgtacgccgcgtcgttgtcg
ggcttcctcaacccgtccgagggctggtggccgacgctgatcggcctggcgatgaacgac
tcgggcggttacaacgccaacagcatgtggggtccgtccagcgacccggcctggaagcgc
aacgacccaatggttcagattccccgcctggtcgccaacaacacccggatctgggtgtac
tgcggtaacggcacacccagcgacctcggcggcgacaacataccggcgaagttcctggaa
ggcctcaccctgcgcaccaaccagaccttccgggacacctacgcggccgacggtggacgc
aacggggtgtttaacttcccgcccaacggaacacactcgtggccctactggaacgagcag
ctggtcgccatgaaggccgatatccagcatgtgctcaacggcgcgacacccccggccgcc
cctgctgcgccggccgcctga

DBGET integrated database retrieval system