KEGG   Mycobacterium tuberculosis CDC1551: MT0268Help
Entry
MT0268            CDS       T00053                                 

Gene name
cobQ-1
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00860  Porphyrin and chlorophyll metabolism
mtc01100  Metabolic pathways
Module
mtc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MT0268 (cobQ-1)
Enzymes [BR:mtc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     MT0268 (cobQ-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 Peptidase_S51 GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AAK44486
UniProt: P9WP94
Position
complement(306489..307973)
Genome map
AA seq 494 aa AA seqDB search
MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNSMVCRGPDGTGVEIGR
AQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVASSSWCAGRRALAEAACR
AFDALAARYDVVVAEGAGSPAEINLRAGDYVNMGLARHAGLPTIVVGDIDRGGVFAAFLG
TVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLERVTGRRVYGTLPWHPDLWLDSEDA
LDLQGRRAAGTGARRVAVVRLPRISNFTDVDALGLEPDLDVVFASDPRALDDADLIVLPG
TRATIADLAWLRARDLDRALLVHVAAGKPLLGICGGFQMLGRVIRDPYGIEGPGGQVTEV
EGLGLLDVETAFSPHKVLRLPRGEGLGVPASGYEIHHGRITRGDTAEEFLGGARDGPVFG
TMWHGSLEGDALREAFLRETLGLAPSGSCFLAARERRLDLLGDLVERHLDVDALLNLARH
GCPPTLPFLAPGAP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctgctggtcgcgggtacgacaagcgacgccggtaagagcgccgtgaccgcg
gggctgtgccgcgcgttggcccgacgcggtgtgcgggtggcgccgtttaaggcgcagaac
atgtccaacaactcgatggtctgccgaggccccgacggcacgggcgtggagatcggtcgg
gcgcaatgggtgcaggcactcgcggctaggaccacgcccgaggcggcgatgaacccggtc
ttgctcaagccggccagtgatcaccgcagccacgtggtgttgatgggcaagccctggggc
gaggtggcgtcgtcaagctggtgtgcggggcggcgagcgctcgccgaggccgcatgccgc
gccttcgacgccctcgccgcccgctacgacgtcgttgtcgcggagggcgccggcagcccg
gccgaaatcaacctgcgcgcaggtgactacgtcaacatggggcttgcccgtcatgcggga
ctgccgaccatcgtcgtcggtgacatcgaccgcggcggggtgttcgctgcgttcctgggc
accgtcgcgttgctggctgccgaggaccaggcgctggtcgcggggtttgtggtcaataag
tttcggggcgactccgacctgctggcgccaggtctgcgcgacctggaacgggtcaccggg
cgcagggtgtacggcaccctgccgtggcaccccgacctctggctggactccgaagatgcc
ctcgacctacagggccggcgcgcggcgggcaccggggcccgccgggtagccgtcgtgcgc
ctgccacgaatcagcaacttcaccgatgtcgacgcattgggtcttgagcccgacttggat
gtcgtgttcgcttccgacccccgcgcgctggacgatgccgatctgatcgtgttgccgggc
acccgggcaacgatcgccgatctagcctggctgagggcgcgagacctagatcgtgcgctg
ctggtgcatgttgcggcgggcaagccgctgctcggcatttgtggcgggttccagatgctg
ggccgggtgattcgcgacccgtacggcatcgaaggtccgggagggcaggtgaccgaggtc
gagggcttgggtttgctcgacgtggagaccgcattttccccccacaaggtgctgcggcta
ccgcgcggcgaaggactcggtgtgcccgcgtcggggtacgagattcaccacggccggatc
acccgcggtgacaccgccgaggagttcctcggcggcgcgcgcgacggaccggtgttcggc
accatgtggcacggctcgttggaaggcgacgccctgcgcgaggccttcctgcgagagacg
ctcggcctcgccccgtcgggctcatgcttcctggccgcacgcgagcgccgcctcgacctg
ctcggcgatctcgtcgaacgacacctcgacgtcgatgcgctgctcaacctggcccgccat
ggttgcccgccgaccttgccctttctcgctccgggcgcgccatga

DBGET integrated database retrieval system