KEGG   Mycobacterium tuberculosis CDC1551: MT0507Help
Entry
MT0507            CDS       T00053                                 

Definition
(GenBank) transporter, LysE/YggA family
  KO
K06895  L-lysine exporter family protein LysE/ArgO
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtc02000]
    MT0507
Transporters [BR:mtc02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   MT0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE
Motif
Other DBs
NCBI-ProteinID: AAK44730
UniProt: P9WK32
Position
579054..579659
Genome map
AA seq 201 aa AA seqDB search
MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLV
ARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVL
IGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIG
VAVVVLVTSPSVPTANVALII
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctcaaggtcgcgatcggcccgcaaaacgcatttgtcctgcgccaaggaatt
aggcgagaatacgtgctggtcattgtggcgctgtgcgggatcgctgatggggcactgatt
gccgcgggcgttggcggcttcgctgcgctgattcacgctcatcccaatatgactttggtt
gcccgatttggcggcgcagcgttcttgattggctacgcgctattggccgcgcggaacgcg
tggcgcccgagcgggctggtgccgtcggaatcggggccggctgcgctgatcggcgtggtg
caaatgtgcctggtggtgacctttctcaacccacacgtctatctggacactgtggtgttg
atcggtgccctcgccaatgaggaatcagatctgcggtggtttttcggagccggtgcctgg
gccgccagcgtcgtatggttcgccgtgttgggatttagcgcgggccggctacagccattc
ttcgcaactccagctgcttggcgcattcttgatgcgctggttgccgtgacgatgattggg
gtcgccgtcgttgtgctcgtcacgtcaccaagtgtgccgacggccaatgtcgcactgatc
atttga

DBGET integrated database retrieval system