KEGG   Mycobacterium tuberculosis CDC1551: MT0570Help
Entry
MT0570            CDS       T00053                                 

Definition
(GenBank) phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MT0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AAK44792
UniProt: P9WIA6
Position
complement(637662..638915)
Genome map
AA seq 417 aa AA seqDB search
MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVAVALSAVLNLIGAFLS
TAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSSSSHALIGGIVGATIAA
VGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRGVAEKRTERGFRRGQIGS
ASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVIVSCAVAMAAGTYLGGWRI
IRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQVATGSVLGSGVGKPGAEVR
WGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAILGFALLWLTATAIWLRSRRAP
IDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPTPPPNHRAPQFGVTTRNAP
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccttcagttgttccttttgctcattgtcgtcgtgacggcattggcgttcgacttc
accaacgggttccacgacaccggaaacgccatggcgacctcgattgccagcggcgccctg
gcaccgcgggtagcggtagcactttctgccgtgctgaacctgatcggtgcgtttttgtcc
accgccgtggcggccacaatcgccaagggtctgatcgacgcgaatctggtgacgctggag
ttggtgttcgccggcctggtcggcgggatcgtctggaacctgttgacctggttgctgggc
attccgtcgagttcctcacatgcgctgatcggcggcatcgtcggcgccacaattgccgcc
gtcggcctgcgtggggtgatctggagcggagtggtgtccaaggtgatcgtgccggccgtg
gtagccgcgctgctggccacgctggtcggagcagtcggcacctggctggtctaccggacg
acgcgcggggttgccgaaaagcgtacggaacgcggtttccggcgcggccagatcggctcg
gcgtcgctggtctcgctggcgcacggcaccaacgacgcgcagaagacgatgggcgtgatc
ttcctggcgttgatgtcctacggcgcggtcagcacgacggcatcggtgccgccgctgtgg
gtgatcgtgagttgcgccgtggccatggccgccggtacctacctgggtggctggcgcatc
atccgcaccctaggcaaagggctggtcgagatcaaaccaccgcagggtatggccgccgag
tcgtcatcggccgccgtcattctgttgtccgcgcacttcggctatgcgctgtccacaacg
caggtcgcgaccgggtccgtgctgggcagcggcgtcggcaagcccggcgccgaggtgcgc
tggggggtagccggccgcatggtggtcgcgtggctggtgacgctcccgttggccgggctg
gtcggggccttcacctacgggctggtgcatttcatcggtggctaccccggtgcgatcctc
ggtttcgcactgttgtggctgaccgccaccgccatctggctgcggtcgcgcagggcgccg
atcgaccacaccaacgtcaacgccgactgggaaggcaacctgacggccggcctggaagcg
ggtgcgcagccgcttgcggatcagaggccgccggtgcctgcaccgccggctccgactccc
ccaccgaaccaccgagcaccacagttcggcgtcaccacgaggaacgccccgtga

DBGET integrated database retrieval system