KEGG   Mycobacterium tuberculosis CDC1551: MT0657Help
Entry
MT0657            CDS       T00053                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MT0657 (recD)
Enzymes [BR:mtc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MT0657 (recD)
DNA repair and recombination proteins [BR:mtc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MT0657 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 AAA_22 UvrD-helicase AAA_16 AAA_25 AAA_29 Herpes_Helicase AAA_28 Mg_chelatase T2SSE NTPase_1 DEAD TrwB_AAD_bind ATPase AAA_23 AAA_5 SRP54 UvrD_C MukB DUF2075 cobW PhoH
Motif
Other DBs
NCBI-ProteinID: AAK44881
UniProt: P9WHJ0
Position
complement(721451..723136)
Genome map
AA seq 561 aa AA seqDB search
MVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRAGSVCVDLLSIARVA
GHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREEEQVCADLLALLTSR
RPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTVARLLALVAEQAELA
GEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVTLHRLLGAKPGARFR
QDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQLASVEAGAVLADLV
DGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSGEERIEFVDDEDPAP
RLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEET
GQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGD
VETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKRKVRVVGSEASVRAA
IARRAVRASGLRMRLQSTGCG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgggccttcaaccaggccggtgtgctggacgtgtcggatgtgcatgtggcgcaa
cgtctctgtgcactggccggggagagcgacgagcgggtggcgttggcggtagcggtggcg
gtccgcgcgctacgggccggttcggtgtgtgtggatctgttgtcgatcgcgcgggttgct
ggacacgacgacctgccgtggccggatccggcggactggttggcggcggtgcgggccagt
ccgttgctcgccgatccacccgtgctgcacctgtatgacgatcggctgctctatctggac
cgctactggcgcgaagaagagcaggtgtgcgcggacctgctcgcgttgctgacatccagg
cgaccggccggggtacccgacttgcggcgactgttcccgaccggctttgacgagcagcgg
cgcgcggcggaaatcgcgctctcgcaaggtgttacggtgttgactggcgggcctggcacc
gggaagacgacgacggtcgcgcggctgctggcgttggttgccgagcaggcggagctggcc
ggtgagccgcggccgcggatcgcgctggccgcacccaccggcaaggcggcggcccggctg
gccgaggcggtacggcgcgagatggccaagctcgacgccaccgaccgggcacggctcggc
gacctgcacgcggtcacgctgcatcgtctgctgggtgccaaaccgggagcgcggtttcgc
caggatcgccagaaccggttgcctcacaacgtgatcgtggtcgacgagacctcgatggtg
tcgctgacgctgatggcccggctggccgaggcggtgcgcccgggcgcccggttgatcctc
gtcggcgatgccgaccagttggcgtcggtggaagccggagcggtgctggcggatttggtc
gatggcttctcggtacgcgacgacgcgctggtggcgcagctgcgaacgtcgcatcggttc
ggcaaggtgatcggtaccttggccgaagcgatccgggccggcgatggcgatgccgtactg
ggcctgctgcgctcgggtgaggagcggatcgagttcgtcgacgacgaggatccggcgccg
cggttgcgcgcggtgctggtgccacacgcgttgcggctgcgcgaggcggcgctgttgggt
gcctccgacgtcgcgttggccaccctggacgagcaccggctgctgtgtgcgcatcgggac
gggcccaccggcgtgctgcactggaaccgccgggttcaagcctggctcgccgaggagacc
ggccagccgccctggacgccgtggtacgccgggcgtccgctgctggtgacggccaacgac
tacggccttcgcgtctacaacggcgacaccggtgtcgtgctggccggccccaccggtctg
cgggccgtcatttctggtgcatccgggccacttgacgttgccaccggccgcctcggcgac
gtcgagaccatgcacgcgatgaccatccacaagagtcagggcagccaggtcgacgaggtg
acggtgctgatgccgcaagaggattcgcggttgctgacccgggagttgctgtacaccgcg
gtgacccgggccaaacgcaaggtccgggtggtcgggtccgaagcttcggtgcgggccgcg
atcgcacgccgggcggtgcgggccagcgggttgcggatgcggttacagtcgacggggtgt
ggctga

DBGET integrated database retrieval system