KEGG   Mycobacterium tuberculosis CDC1551: MT0706
Entry
MT0706            CDS       T00053                                 

Definition
(GenBank) membrane protein, MmpS family
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Motif
Pfam: Mycobact_memb
Other DBs
NCBI-ProteinID: AAK44931
UniProt: P9WJS6
Position
complement(780451..780879)
AA seq 142 aa
MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFADDPEPFDPKVVEYEV
SGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNILAQGDGTSITCRITVDG
EVKDERTATGVDALTYCFVKSA
NT seq 429 nt   +upstreamnt  +downstreamnt
atgattggaactctcaagcgtgcctggataccgctgctcatcctggttgtggtcgccatc
gccggcttcacggtgcagcggatccgcactttctttggttccgaaggcatcttggtgacg
ccgaaggtcttcgccgatgacccggagccgttcgaccccaaggtggtggagtacgaagtt
tccggctccggtagttacgtcaacatcaactacctggacctcgacgccaagccacagcgg
atcgacggcgcagccctgccgtggtcgctcaccttgaagaccacggcgccgtccgcggcc
cccaacatcctcgcgcaaggcgacggcacttccatcacctgccgaatcaccgtcgatggc
gaagtgaaggacgagcggaccgcaaccggcgtggatgccctgacctactgctttgtgaaa
tccgcatga

DBGET integrated database retrieval system