KEGG   Mycobacterium tuberculosis CDC1551: MT0837
Entry
MT0837            CDS       T00053                                 

Gene name
sseA-1
Definition
(GenBank) thiosulfate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00270  Cysteine and methionine metabolism
mtc00920  Sulfur metabolism
mtc01100  Metabolic pathways
mtc01120  Microbial metabolism in diverse environments
mtc04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MT0837 (sseA-1)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MT0837 (sseA-1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    MT0837 (sseA-1)
Enzymes [BR:mtc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     MT0837 (sseA-1)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     MT0837 (sseA-1)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-ProteinID: AAK45079
UniProt: P9WHF8
Structure
PDB: 
3AAY 3HWI 3AAX

Position
complement(908394..909227)
AA seq 277 aa
MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFV
DAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDG
RPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLP
QEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSS
HTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcacgctgcgatgtcctggtctccgccgactgggctgagagcaatctgcacgcgccg
aaggtcgttttcgtcgaagtggacgaggacaccagtgcatatgaccgtgaccatattgcc
ggcgcgatcaagttggactggcgcaccgacctgcaggatccggtcaaacgtgacttcgtc
gacgcccagcaattctccaagctgctgtccgagcgtggcatcgccaacgaggacacggtg
atcctgtacggcggcaacaacaattggttcgccgcctacgcgtactggtatttcaagctc
tacggccatgagaaggtcaagttgctcgacggcggccgcaagaagtgggagctcgacgga
cgcccgctgtccagcgacccggtcagccggccggtgacctcctacaccgcctccccgccg
gataacacgattcgggcattccgcgacgaggtcctggcggccatcaacgtcaagaacctc
atcgacgtgcgctctcccgacgagttctccggcaagatcctggcccccgcgcacctgccg
caggaacaaagccagcggcccggacacattcctggtgccatcaacgtgccgtggagcagg
gccgccaacgaggacggcaccttcaagtccgatgaggagttggccaagctttacgccgac
gccggcctagacaacagcaaggaaacgattgcctactgccgaatcggggaacggtcctcg
cacacctggttcgtgttgcgggaattactcggacaccaaaacgtcaagaactacgacggc
agttggacagaatacggctccctggtgggcgccccgatcgagttgggaagctga

DBGET integrated database retrieval system