KEGG   Mycobacterium tuberculosis CDC1551: MT1015
Entry
MT1015            CDS       T00053                                 

Name
(GenBank) conserved hypothetical protein
  KO
K02004  putative ABC transport system permease protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtc02000]
    MT1015
Transporters [BR:mtc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    MT1015
SSDB
Motif
Pfam: FtsX MacB_PCD
Other DBs
NCBI-ProteinID: AAK45263
UniProt: Q7D911
Position
1102581..1105148
AA seq 855 aa
MNDQAPVAYAPLWRTAWRRLRQRPFQYILLVLGIALGVAMIVAIDVSSNSAQRAFDLSAA
AITGKSTHRLVSGPAGVDQQLYFDLRRHGYDFSAPVIEGYVLARGLGNRAMQFMGTDPFA
ESAFRSPLWSNQNIAELGGFLTRPNGVVLSRQVAQKYGLAVGDRIALQVKGAPTTVTLVG
LLTPADEVSNQKLSDLIIADISTAQELFHMPGRLSHIDLIIKDEATATRIQQRLPAGVRM
ETSDTQRDTVKQMTDAFTVNLTALSLIALLVGIFLIYNTVTFNVVQRRPFFAILRCLGVT
REQLFWLIMTESLVAGLIGTGLGLLIGIWLGEGLIGLVTQTINDFYFVINVRNVSVSAES
LLKGLIIGIFAAMLATLPPAIEAMRTVPASTLRRSSLESKITKLMPWLWVAWFGLGSFGV
LMLWLPGNNLVVAFVGLFSVLIALALIAPPLTRFVMLRLAPGLGRLLGPIGRMAPRNIVR
SLSRTSIAIAALMMAVSLMVGVSISVGSFRQTLANWLEVTLKSDVYVSPPTLTSGRPSGN
LPVDAVRNISKWPGVRDAVMARYSSVFAPDWGREVELMAVSGDISDGKRPYRWIDGNKDT
LWPRFLAGKGVMLSEPMVSRQHLQMPPRPITLMTDSGPQTFPVLAVFSDYTSDQGVILMD
RASYRAHWQDDDVTTMFLFLASGANSGALIDQLQAAFAGREDIVIQSTHSVREASMFIFD
RSFTITIALQLVATVVAFIGVLSALMSLELDRAHELGVFRAIGMTTRQLWKLMFIETGLM
GGMAGLMALPTGCILAWILVRIINVRSFGWTLQMHFESAHFLRALLVAVVAALAAGMYPA
WRLGRMTIRTAIREE
NT seq 2568 nt   +upstreamnt  +downstreamnt
atgaatgaccaagctcccgttgcttatgcaccactatggcgcacggcgtggcgtcggctg
cgtcagcggccgtttcaatatattctgctggtcctgggaattgcgctaggcgttgccatg
atcgtggctatcgatgtatccagtaattcggcgcaacgtgccttcgatctctctgccgcg
gccatcaccggaaaatctactcaccggctggtcagtggccccgccggggtggaccaacag
ctttatttcgatctgcgccgacacgggtacgatttttccgctccggtaatcgaaggctat
gtgttggcccgcggactgggaaaccgagctatgcagttcatgggcaccgacccatttgcg
gagtcagcttttcgctcgcctttatggtccaaccaaaatatcgccgagttgggtggcttt
ttgactcgacccaacggtgtcgtgttaagccgacaagtggcacagaagtatggcttggct
gtgggcgatcgcattgctctgcaagtgaaaggtgcgcctaccacagtaaccctggtggga
ttgctgacacctgcagatgaagttagcaatcaaaaattgtccgaccttatcattgctgat
atttccacggcccaagagttgttccatatgcccggaagactgagccacatcgatttgatc
atcaaagatgaggccactgcaacacgcatccaacaaagactgccggccggtgtgcgtatg
gaaacgtcggatacccaacgggacaccgtcaaacagatgacggacgcttttacggtcaat
ttaaccgctctcagtttgattgccttgttggtgggtatctttttaatctacaataccgtg
acatttaatgtcgtgcaacggcgaccgtttttcgccatattgcgctgtttgggtgtaacc
cgagagcagttattttggctgataatgacggaatccctcgttgccgggctgattggtacg
ggcttgggcctcttgattggaatttggctcggcgaaggcttgatcggcctggtgactcaa
accatcaatgatttctattttgtcatcaatgttcgcaatgtgtccgtctccgccgaaagc
ttgttgaaggggctgatcatcggcatctttgccgccatgttagccacactgccaccggct
atagaagcgatgcgcaccgtccctgccagcacattgcggcgctcctccctggaaagcaag
ataaccaagctcatgccgtggttgtgggtggcgtggtttggtttgggtagctttggtgta
ttgatgctgtggttgccgggcaacaacctggttgtggcctttgtcggtctctttagtgtg
ctgattgccctggcgcttattgccccgccgctgacccggtttgtaatgttgcgcttagct
cctggcttaggacggctgctcggtccaataggtcgaatggcgccacgcaatattgtgcgc
tcgttgagtcgcacctctatcgccatcgccgccctgatgatggccgtgtccttgatggta
ggcgtctccatatcggtggggtcgtttcgacagacgctggccaattggctagaggtgact
ttgaagtcggatgtctatgtgtctccgccgaccttaacatccggtcgccccagcggtaat
ctgcctgtggatgccgtccggaatataagcaaatggccaggagtgcgtgacgcagttatg
gctcggtatagttccgtttttgccccggactgggggcgtgaggtggaactaatggcggtg
tcgggtgatatttccgacggcaagcgaccatataggtggatcgacggcaataaagacacg
ctctggccacgtttcttggcggggaaaggggtgatgctatcggagccaatggtatcgcga
caacacttgcagatgccgccaaggccgatcacgctaatgacggattcggggccacaaacg
ttccccgttctggcggttttctctgactacacctcagatcaaggtgtgattttgatggat
cgcgccagttatcgggcccattggcaggatgatgacgtgacgaccatgtttctttttttg
gcatcgggtgcgaatagcggtgccttgatagatcaactacaagccgcgttcgcgggtcgg
gaagacattgttattcaatcgactcatagtgtccgcgaagcatcaatgttcatatttgat
cgtagttttaccattaccatcgcgttgcaactggtggccacggtggtggcttttattggc
gtactgagcgcgctgatgagtttggaattggaccgggctcatgagttgggtgtttttcgc
gccattggcatgactacccgccaattatggaagctgatgttcattgagaccggcctaatg
ggcgggatggccggcttgatggccttgccaactggttgtattctagcgtggattcttgtc
cgcattatcaatgtccgctcattcggctggaccttgcagatgcactttgagtcggcgcat
tttcttcgagccctgttggtagcggtggtggccgccctggcggcgggtatgtaccccgct
tggcgtttgggacggatgacgattcgcacggcgattcgtgaggaatga

DBGET integrated database retrieval system