KEGG   Mycobacterium tuberculosis CDC1551: MT1169Help
Entry
MT1169            CDS       T00053                                 

Definition
(GenBank) ketoacyl-CoA thiolase-related protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00071  Fatty acid degradation
mtc00072  Synthesis and degradation of ketone bodies
mtc00280  Valine, leucine and isoleucine degradation
mtc00310  Lysine degradation
mtc00362  Benzoate degradation
mtc00380  Tryptophan metabolism
mtc00620  Pyruvate metabolism
mtc00630  Glyoxylate and dicarboxylate metabolism
mtc00640  Propanoate metabolism
mtc00650  Butanoate metabolism
mtc00900  Terpenoid backbone biosynthesis
mtc01100  Metabolic pathways
mtc01110  Biosynthesis of secondary metabolites
mtc01120  Microbial metabolism in diverse environments
mtc01130  Biosynthesis of antibiotics
mtc01200  Carbon metabolism
mtc01212  Fatty acid metabolism
mtc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MT1169
   00630 Glyoxylate and dicarboxylate metabolism
    MT1169
   00640 Propanoate metabolism
    MT1169
   00650 Butanoate metabolism
    MT1169
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MT1169
   00072 Synthesis and degradation of ketone bodies
    MT1169
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MT1169
   00310 Lysine degradation
    MT1169
   00380 Tryptophan metabolism
    MT1169
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MT1169
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MT1169
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MT1169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtc04147]
    MT1169
Enzymes [BR:mtc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MT1169
Exosome [BR:mtc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MT1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AAK45426
UniProt: Q8VK64
Position
1263861..1264103
Genome map
AA seq 80 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSAYPLFNPNSAIALGHPFGGSGARLMTTVLHHMPDKGIRY
GLQTMCEGRGQANATIVELL
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttaccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcgggggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggccaagccaatgccaccattgtggagttgctg
tga

DBGET integrated database retrieval system