KEGG   Mycobacterium tuberculosis CDC1551: MT1258
Entry
MT1258            CDS       T00053                                 

Definition
(GenBank) O-methyltransferase
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_31 Methyltransf_25 Methyltransf_11 MTS PCMT Ubie_methyltran GCD14
Other DBs
NCBI-ProteinID: AAK45515
UniProt: P9WJZ6
Structure
PDB: 
5X7F

Position
complement(1362990..1363637)
AA seq 215 aa
MPGQPAPSRGESLWAHAEGSISEDVILAGARERATDIGAGAVTPAVGALLCLLAKLSGGK
AVAEVGTGAGVSGLWLLSGMRDDGVLTTIDIEPEHLRLARQAFAEAGIGPSRTRLISGRA
QEVLTRLADASYDLVFIDADPIDQPDYVAEGVRLLRSGGVIVVHRAALGGRAGDPGARDA
EVIAVREAARLIAEDERLTPALVPLGDGVLAAVRD
NT seq 648 nt   +upstreamnt  +downstreamnt
atgcctggccagccggcccccagccgaggcgaatcactctgggcgcacgccgaggggtca
atatctgaagacgtgatcctggccggcgcccgcgagcgcgcaaccgacatcggggccggg
gcggtaacaccggcggtgggtgcgttgctgtgcttgctggccaagctcagcggaggcaag
gcggtggccgaagtgggtaccggggccggcgtcagcggcctgtggctgttgtcgggcatg
cgcgacgacggcgtcttgaccaccatcgatatcgagcccgagcatctacgccttgccagg
caggcctttgccgaggcgggcatcgggccgtcgcgtaccaggctgatcagcggccgcgcc
caagaggtgctgacccggctcgccgacgcatcctacgacctggtattcatcgacgccgac
ccgatcgaccagccagattacgtcgccgagggggtgcggctgctgcgatccggcggggtc
atcgtcgtgcaccgggcggcgctgggcggtcgggccggtgatcccggggcgcgcgacgcc
gaggtgatcgcggttcgcgaggcggcccggcttatcgccgaggatgaacggctcactccg
gcactggtgccgctgggcgacggcgtgctggcagccgtgcgggactaa

DBGET integrated database retrieval system