KEGG   Mycobacterium tuberculosis CDC1551: MT1297
Entry
MT1297            CDS       T00053                                 
Symbol
tap
Name
(GenBank) multidrug resistance efflux protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Motif
Pfam: MFS_1 MFS_3 Sugar_tr CAAD
Other DBs
NCBI-ProteinID: AAK45555
UniProt: P9WJX8
Position
complement(1405568..1406827)
AA seq 419 aa
MRNSNRGPAFLILFATLMAAAGDGVSIVAFPWLVLQREGSAGQASIVASATMLPLLFATL
VAGTAVDYFGRRRVSMVADALSGAAVAGVPLVAWGYGGDAVNVLVLAVLAALAAAFGPAG
MTARDSMLPEAAARAGWSLDRINGAYEAILNLAFIVGPAIGGLMIATVGGITTMWITATA
FGLSILAIAALQLEGAGKPHHTSRPQGLVSGIAEGLRFVWNLRVLRTLGMIDLTVTALYL
PMESVLFPKYFTDHQQPVQLGWALMAIAGGGLVGALGYAVLAIRVPRRVTMSTAVLTLGL
ASMVIAFLPPLPVIMVLCAVVGLVYGPIQPIYNYVIQTRAAQHLRGRVVGVMTSLAYAAG
PLGLLLAGPLTDAAGLHATFLALALPIVCTGLVAIRLPALRELDLAPQADIDRPVGSAQ
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagaaacagcaaccgcggcccggcattcctgatcctgttcgcaacgctgatggcggcc
gcgggtgatggcgtctcgatagtcgcgtttccgtggctggtgttgcagcgcgagggcagc
gctgggcaggcctcgatcgtggccagtgcgaccatgctgccgctgttgttcgccacgctg
gtcgccggcaccgcggtcgactacttcgggcgtcgccgggtgtcgatggtggccgatgcg
ctgtcgggtgcggcggtggccggcgtccccctggtggcgtgggggtacggcggcgacgcg
gtcaacgtgctggtgctggccgtattggccgccctggcggccgccttcggcccggcaggc
atgacggctcgtgactcgatgctgcccgaggccgccgctcgggcaggctggtcgttggac
cgcatcaacggcgcctacgaggcgatcctcaacctggcctttattgtcggcccggccatc
ggtggcttgatgatcgcgacggttggcggcatcaccacaatgtggattaccgcgacggca
ttcgggttgtccatcctcgcgattgccgccctgcaactcgagggtgccggcaagccgcac
cacacctcgcggccccaagggttggtatccgggatcgccgaggggctgcgcttcgtctgg
aacctgcgggtattgcgcaccctcgggatgattgacctgaccgtcaccgcgctgtatctg
ccgatggagagcgtgctgttcccgaaatacttcaccgaccaccagcaaccggtgcagctg
ggttgggcgttgatggcgatcgccggcggcggcctggtgggagcgctggggtatgccgtg
ttggctatccgcgttccccgtcgcgtgaccatgtcgaccgcggttcttaccctgggtttg
gcatcgatggtcatcgcgttcctgccgccactgccggtcatcatggtgttgtgcgcggtg
gtcggcctggtgtacggacccatccagccgatctataactacgtgatacagacgcgggca
gcacagcatctgcgcggccgggtagtcggggtgatgacgtcgctggcctacgccgccggc
ccgttgggtctgttgctggccggtccactgaccgacgccgctggactgcatgccacgttt
ctcgcgttggcactgcccatcgtgtgcaccgggctggtcgcgatccggctgcccgcgctg
cgcgaactggatctggcgccccaagcggacatcgatcggcccgtaggatcggctcagtga

DBGET integrated database retrieval system