KEGG   Mycobacterium tuberculosis CDC1551: MT1454
Entry
MT1454            CDS       T00053                                 
Name
(GenBank) sugar transporter family protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Motif
Pfam: MFS_1 Sugar_tr TRI12 FtsX
Other DBs
NCBI-ProteinID: AAK45719
UniProt: P9WJY2
Position
complement(1586064..1587620)
AA seq 518 aa
MRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMNSVGIPINQLHRITWIVTMYLLGYIA
AMPLLGRASDRFGRKLMLQVSLAGFIIGSVVTALAGHFGDFHMLIAGRTIQGVASGALLP
ITLALGADLWSQRNRAGVLGGIGAAQELGSVLGPLYGIFIVWLLHDWRDVFWINVPLTAI
AMVMIHFSLPSHDRSTEPERVDLVGGLLLALALGLAVIGLYNPNPDGKHVLPDYGAPLLV
GALVAAVAFFGWERFARTRLIDPAGVHFRPFLSALGASVAAGAALMVTLVDVELFGQGVL
QMDQAQAAGMLLWFLIALPIGAVTGGWIATRAGDRAVAFAGLLIAAYGYWLISHWPVDLL
ADRHNILGLFTVPAMHTDLVVAGLGLGLVIGPLSSATLRVVPSAQHGIASAAVVVARMTG
MLIGVAALSAWGLYRFNQILAGLSAAIPPNASLLERAAAIGARYQQAFALMYGEIFTITA
IVCVFGAVLGLLISGRKEHADEPEVQEQPTLAPQVEPL
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgcgagcaggacgtcgagtcgcgattagcgcgggcagcctggcagtactgctgggcgcc
ctggacacctatgtcgtggtcaccatcatgcgcgacatcatgaacagcgttggtataccg
atcaaccaactccaccggatcacctggatcgtcacgatgtacctcctgggctacatcgcc
gccatgccgttgctgggccgggcttccgaccgattcgggcgcaagctgatgctgcaggtc
agcctggccgggttcatcatcggctcggtagtgaccgcgctggccgggcattttggcgat
ttccacatgctgatcgcgggccgcacgatccagggtgttgccagcggcgcgctattgccg
atcacgctggcgctgggcgccgatttgtggtcgcagcgcaaccgcgccggcgtgctcggc
ggtatcggcgccgcgcaggagctcggcagcgttctgggcccgttgtacggaatcttcatc
gtttggctattgcacgactggcgtgacgtgttctggatcaacgtcccgttgaccgcgatc
gccatggtaatgatccacttcagcctgccctcacacgaccgcagcacggagcccgagcga
gtcgacctggtcggtggtctgctgctggcactcgcgttgggcctcgccgtcatcgggctg
tacaaccccaatcccgacggcaaacacgtactgccggactacggggctccgttgctggtc
ggcgctctcgttgccgcggtggcgttcttcggttgggaacgtttcgctcgcacccggctg
atcgacccggccggtgtgcacttccggccgttcctgtccgcgctgggtgcctccgtcgcc
gccggcgcggcgctgatggtgacgctggttgatgtcgagctgttcggccagggcgtgctg
cagatggaccaggctcaggcggccggaatgctgctgtggttccttatcgccctaccgatc
ggggcagtgacgggcgggtggatcgccaccagggccggtgaccgtgcggtggcctttgcc
ggactgcttattgcggcgtacggttactggcttatttcccactggccggtggacctgttg
gccgatcggcacaacatcctcggattgttcaccgtgccggcgatgcacaccgacctggtg
gtggctggtttagggttggggctggtgatcgggccgctatcgtcggccaccctacgggtt
gtcccgtcggcccagcacggcatcgcttcggcggcggtggtggtcgcccggatgaccggc
atgttgatcggcgtggccgcgctgagcgcctgggggttgtaccggttcaaccagatcctg
gcggggttgtcggcggccatcccgcccaacgccagcctgctcgagcgcgcggccgcaatt
ggagcccggtaccagcaggcgttcgcgctgatgtacggcgagatattcaccatcaccgcg
atcgtgtgcgtgttcggcgcggtgctaggtctgttgatcagcggccgcaaggaacatgcc
gatgaaccggaagtccaggagcaaccgaccctggcgccccaagtggagccgctctaa

DBGET integrated database retrieval system