KEGG   Mycobacterium tuberculosis CDC1551: MT1670Help
Entry
MT1670            CDS       T00053                                 

Definition
(GenBank) drug transporter, putative
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AAK45940
UniProt: P9WJX2
Position
1830075..1831490
Genome map
AA seq 471 aa AA seqDB search
MTETASETGSWRELLSRYLGTSIVLAGGVALYATNEFLTISLLPSTIADIGGSRLYAWVT
TLYLVGSVVAATTVNTMLLRVGARSSYLMGLAVFGLASLVCAAAPSMQILVAGRTLQGIA
GGLLAGLGYALINSTLPKSLWTRGSALVSAMWGVATLIGPATGGLFAQLGLWRWAFGVMT
LLTALMAMLVPVALGAGGVGPGGETPVGSTHKVPVWSLLLMGAAALAISVAALPNYLVQT
AGLLAAAALLVAVFVVVDWRIHAAVLPPSVFGSGPLKWIYLTMSVQMIAAMVDTYVPLFG
QRLGHLTPVAAGFLGAALAVGWTVGEVASASLNSARVIGHVVAAAPLVMASGLALGAVTQ
RADAPVGIIALWALALLIIGTGIGIAWPHLTVRAMDSVADPAESSAAAAAINVVQLISGA
FGAGLAGVVVNTAKGGEVAAARGLYMAFTVLAAAGVIASYQATHRDRRLPR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaacagcgagcgagaccggcagctggcgtgagctactgagcaggtatctgggc
acctccatagtgctggccggtggcgtcgcgctttacgccaccaacgagtttctgacaatc
agcctgctgccgagcacaatcgccgacatcgggggtagccggctgtacgcctgggtgaca
accctgtatctggtcgggtcggtggtggcggcgaccaccgtcaatacgatgttgctgcgc
gtcggggcgcgctcgtcgtatctgatggggttggccgtcttcggtctggccagcctggta
tgtgcggcggcgccgagcatgcagattctggtggccgggcgtaccttgcaaggaatagcc
ggtgggctgctggccggcctaggctacgcgctgatcaactcgaccttgcccaagtcgctg
tggacccgtggctcagcactggtgtcggcgatgtggggggtcgcgacgctgatcggaccg
gcgaccggaggccttttcgcgcagctcgggctgtggcgatgggcgttcggcgtgatgacg
ttgctgaccgcgttgatggccatgttggtgccggtcgcgctcggtgccgggggggtcggc
ccgggcggcgagacgccggtgggcagcacacacaaggtgccggtgtggtcgctattgctg
atgggggccgccgcactggcgatcagcgtcgccgcgcttccgaactacctcgtccagacg
gccgggctgctagccgccgccgcgctgctggttgcggtgtttgtggtagtcgactggcgg
atacacgcagcggtgttgccgcccagcgtatttggctccggaccgttgaaatggatttac
ctgaccatgtcggtgcagatgattgcggcaatggtcgatacctacgtgccgctgttcggt
cagcgactgggacacctgaccccggtggcagccgggttcttgggtgccgcgctggcggtg
ggctggacggtcggtgaggtcgccagcgcctcgttgaacagtgcacgagttatcgggcat
gtcgtggcagccgcaccgctggtgatggcgtcggggttggcgctaggcgccgtcacccag
cgcgccgatgcgccggtggggatcatcgcgctgtgggcgctggcgctgctgatcatcggg
accggcatcgggatcgcctggccgcatctaacggtgcgcgctatggattctgtcgccgac
ccggccgagagcagcgcggcggccgcggcgatcaatgtcgtacagctgatctccggtgct
ttcggcgccgggctggccggtgtggtggtcaacactgccaagggcggcgaagtggcggcg
gctcgtgggctatacatggcatttacggtgctggccgccgctggtgtcatcgcctcctac
caggccacgcaccgcgaccggcgcttaccgcgttga

DBGET integrated database retrieval system