KEGG   Mycobacterium tuberculosis CDC1551: MT1934Help
Entry
MT1934            CDS       T00053                                 

Gene name
fbpB
Definition
(GenBank) esterase, putative, antigen 85-B
  KO
K18851  diacylglycerol O-acyltransferase / trehalose O-mycolyltransferase [EC:2.3.1.20 2.3.1.122]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00561  Glycerolipid metabolism
mtc00572  Arabinogalactan biosynthesis - Mycobacterium
mtc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    MT1934 (fbpB)
  09107 Glycan biosynthesis and metabolism
   00572 Arabinogalactan biosynthesis - Mycobacterium
    MT1934 (fbpB)
Enzymes [BR:mtc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     MT1934 (fbpB)
    2.3.1.122  trehalose O-mycolyltransferase
     MT1934 (fbpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Esterase
Motif
Other DBs
NCBI-ProteinID: AAK46207
UniProt: P9WQP0
Structure
PDB: 

Position
complement(2132126..2133250)
Genome map
AA seq 374 aa AA seqDB search
MSPLSTLALSAAVTDTEMRRLCARIDIWPPHTVCSGPSTRRHTGQRGTGMTDVSRKIRAW
GRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGN
NSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAG
CQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSA
LLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYC
GNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQL
NAMKGDLQSSLGAG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagccccctaagcacacttgctctgtccgcggcggtaaccgatacggaaatgagacga
ctttgcgcccgaatcgacatttggcctccacacacggtatgttctggcccgagcacacga
cgacatacaggacaaaggggcacaggtatgacagacgtgagccgaaagattcgagcttgg
ggacgccgattgatgatcggcacggcagcggctgtagtccttccgggcctggtggggctt
gccggcggagcggcaaccgcgggcgcgttctcccggccggggctgccggtcgagtacctg
caggtgccgtcgccgtcgatgggccgcgacatcaaggttcagttccagagcggtgggaac
aactcacctgcggtttatctgctcgacggcctgcgcgcccaagacgactacaacggctgg
gatatcaacaccccggcgttcgagtggtactaccagtcgggactgtcgatagtcatgccg
gtcggcgggcagtccagcttctacagcgactggtacagcccggcctgcggtaaggctggc
tgccagacttacaagtgggaaaccttcctgaccagcgagctgccgcaatggttgtccgcc
aacagggccgtgaagcccaccggcagcgctgcaatcggcttgtcgatggccggctcgtcg
gcaatgatcttggccgcctaccacccccagcagttcatctacgccggctcgctgtcggcc
ctgctggacccctctcaggggatggggcctagcctgatcggcctcgcgatgggtgacgcc
ggcggttacaaggccgcagacatgtggggtccctcgagtgacccggcatgggagcgcaac
gaccctacgcagcagatccccaagctggtcgcaaacaacacccggctatgggtttattgc
gggaacggcaccccgaacgagttgggcggtgccaacatacccgccgagttcttggagaac
ttcgttcgtagcagcaacctgaagttccaggatgcgtacaacgccgcgggcgggcacaac
gccgtgttcaacttcccgcccaacggcacgcacagctgggagtactggggcgctcagctc
aacgccatgaagggtgacctgcagagttcgttaggcgccggctga

DBGET integrated database retrieval system