KEGG   Mycobacterium tuberculosis CDC1551: MT1988
Entry
MT1988            CDS       T00053                                 
Name
(GenBank) epoxide hydrolase
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr
Other DBs
NCBI-ProteinID: AAK46260
UniProt: P95276
Structure
Position
2188359..2189429
AA seq 356 aa
MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAI
DQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDR
CAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEE
DLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVY
PETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQ
YDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP
NT seq 1071 nt   +upstreamnt  +downstreamnt
gtgtcgcaggtccatcgaatcctgaactgccggggcacccgcatccatgccgtggcggac
agcccacccgaccaacagggaccgttggtggtgttgctgcacgggtttccggagtcctgg
tactcgtggcggcatcagattcccgcgcttgccggcgcgggctaccgcgtggtggccatc
gaccagcgcgggtatggccgctcgtcgaaataccgggtgcaaaaggcctaccgcatcaag
gaattggttggcgacgtcgtgggcgtcctcgactcctatggtgcggagcaggctttcgtg
gtgggccacgactggggtgcgccggtcgcctggaccttcgcctggctgcaccccgaccga
tgcgccggcgtggtgggaatcagcgttccgtttgccggtcgcggcgtgatcggcctgccg
ggcagcccgttcggcgagcgccgtcccagcgactaccacctggagctggccgggcccgga
agggtctggtatcaggactatttcgccgtgcaggacggcatcatcaccgagatcgaggaa
gacttgcggggctggctgctcgggttgacctacaccgtttccggtgaggggatgatggcg
gcgaccaaggcggccgtcgacgcgggcgtcgacctggagtccatggacccgatcgacgtg
atccgtgccggaccgctgtgtatggccgaaggcgcgcggctcaaggacgcgttcgtctac
ccggagaccatgccggcctggttcaccgaggccgatctcgatttctacactggcgaattc
gaacgttccgggttcggcgggccgctgagcttctaccacaacatcgacaacgactggcac
gacctggccgaccagcaaggcaagccgctcaccccgccggctctgttcatcggcggccag
tatgacgtcggcaccatctggggcgcgcaggccatcgagcgtgcgcacgaagtcatgccg
aactaccgcggcacccacatgatcgccgacgtcggacactggatccagcaggaagcgccc
gaagagaccaaccggctgttgctcgacttcctaggcgggctgcggccgtga

DBGET integrated database retrieval system