KEGG   Mycobacterium tuberculosis CDC1551: MT2258Help
Entry
MT2258            CDS       T00053                                 

Definition
(GenBank) carbohydrate kinase, PfkB family
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00230  Purine metabolism
mtc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MT2258
Enzymes [BR:mtc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     MT2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AAK46544
UniProt: P9WID4
Structure
PDB: 

Position
complement(2464330..2465304)
Genome map
AA seq 324 aa AA seqDB search
MTIAVTGSIATDHLMRFPGRFSEQLLPEHLHKVSLSFLVDDLVMHRGGVAGNMAFAIGVL
GGEVALVGAAGADFADYRDWLKARGVNCDHVLISETAHTARFTCTTDVDMAQIASFYPGA
MSEARNIKLADVVSAIGKPELVIIGANDPEAMFLHTEECRKLGLAFAADPSQQLARLSGE
EIRRLVNGAAYLFTNDYEWDLLLSKTGWSEADVMAQIDLRVTTLGPKGVDLVEPDGTTIH
VGVVPETSQTDPTGVGDAFRAGFLTGRSAGLGLERSAQLGSLVAVLVLESTGTQEWQWDY
EAAASRLAGAYGEHAAAEIVAVLA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcgcggtaaccggttcgattgcgaccgaccatttgatgcggtttccaggccga
ttttccgagcagctactgcccgaacacctgcacaaggtgtcgcttagcttcctagtcgat
gacttggtgatgcaccgcggcggcgtggccggaaacatggccttcgccatcggtgtgcta
ggtggcgaggtcgcgctagttggggcggcaggcgccgacttcgccgattatcgcgactgg
ctgaaagcccgcggtgtcaactgcgaccacgttctgatctccgagaccgcgcacacggcg
cggtttacctgtaccaccgatgtcgacatggcccagatcgcatcgttctaccccggggct
atgtcggaggcacgtaacatcaagcttgccgacgtggtgtcggccatcggcaagccggag
ttggtgatcatcggcgccaacgaccccgaggcgatgttcttgcacaccgaggagtgtcgc
aagctggggctggccttcgccgccgatccgtctcagcagctggcgaggctgtcgggtgag
gaaattcgcaggctcgtcaacggtgctgcttacttgttcaccaacgactacgaatgggat
ctgctgctgtccaagaccggctggtcagaggccgatgtgatggcgcagatcgacctgcgg
gtgaccacattgggtcctaagggtgtcgatttggtagaacctgacggcaccaccatccac
gtcggcgtggtccccgaaaccagccagaccgaccccaccggcgtcggcgacgckttccgc
gccggtttcctgactggccgcagtgccggactaggcctggagcgttcggcgcagctgggc
tcgctggttgccgtgctggtgctggagtcgaccggaactcaggagtggcagtgggactac
gaggccgcggccagcaggctggctggtgcttacggcgagcacgcggccgccgagatcgtc
gccgtgctggcctag

DBGET integrated database retrieval system