KEGG   Mycobacterium tuberculosis CDC1551: MT2301Help
Entry
MT2301            CDS       T00053                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase, E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00010  Glycolysis / Gluconeogenesis
mtc00020  Citrate cycle (TCA cycle)
mtc00620  Pyruvate metabolism
mtc01100  Metabolic pathways
mtc01110  Biosynthesis of secondary metabolites
mtc01120  Microbial metabolism in diverse environments
mtc01130  Biosynthesis of antibiotics
mtc01200  Carbon metabolism
Module
mtc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT2301 (aceE)
   00020 Citrate cycle (TCA cycle)
    MT2301 (aceE)
   00620 Pyruvate metabolism
    MT2301 (aceE)
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MT2301 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AAK46585
UniProt: P9WIS8
Position
2509812..2512517
Genome map
AA seq 901 aa AA seqDB search
MASYLPDIDPEETSEWLESFDTLLQRCGPSRARYLMLRLLERAGEQRVAIPALTSTDYVN
TIPTELEPWFPGDEDVERRYRAWIRWNAAIMVHRAQRPGVGVGGHISTYASSAALYEVGF
NHFFRGKSHPGGGDQVFIQGHASPGIYARAFLEGRLTAEQLDGFRQEHSHVGGGLPSYPH
PRLMPDFWEFPTVSMGLGPLNAIYQARFNHYLHDRGIKDTSDQHVWCFLGDGEMDEPESR
GLAHVGALEGLDNLTFVINCNLQRLDGPVRGNGKIIQELESFFRGAGWNVIKVVWGREWD
ALLHADRDGALVNLMNTTPDGDYQTYKANDGGYVRDHFFGRDPRTKALVENMSDQDIWNL
KRGGHDYRKVYAAYRAAVDHKGQPTVILAKTIKGYALGKHFEGRNATHQMKKLTLEDLKE
FRDTQRIPVSDAQLEENPYLPPYYHPGLNAPEIRYMLDRRRALGGFVPERRTKSKALTLP
GRDIYAPLKKGSGHQEVATTMATVRTFKEVLRDKQIGPRIVPIIPDEARTFGMDSWFPSL
KIYNRNGQLYTAVDADLMLAYKESEVGQILHEGINEAGSVGSFIAAGTSYATHNEPMIPI
YIFYSMFGFQRTGDSFWAAADQMARGFVLGATAGRTTLTGEGLQHADGHSLLLAATNPAV
VAYDPAFAYEIAYIVESGLARMCGENPENIFFYITVYNEPYVQPPEPENFDPEGVLRGIY
RYHAATEQRTNKAQILASGVAMPAALRAAQMLAAEWDVAADVWSVTSWGELNRDGVAIET
EKLRHPDRPAGVPYVTRALENARGPVIAVSDWMRAVPEQIRPWVPGTYLTLGTDGFGFSD
TRPAARRYFNTDAESQVVAVLEALAGDGEIDPSVPVAAARQYRIDDVAAAPEQTTDPGPG
A
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcgtatttgcccgacattgatcccgaggagacctcggagtggctggagtccttt
gacacgctgctgcaacgctgcggcccgtcgcgggcccgctacctgatgttgcggctgcta
gagcgggccggcgagcagcgggtggccatcccggcattgacgtctaccgactatgtcaac
accatcccgaccgagctggagccgtggttccccggcgacgaagacgtcgaacgtcgttat
cgagcgtggatcagatggaatgcggccatcatggtgcaccgtgcgcaacgaccgggtgtg
ggcgtgggtggccatatctcgacctacgcgtcgtccgcggcgctctatgaggtcggtttc
aaccacttcttccgcggcaagtcgcacccgggcggcggcgatcaggtgttcatccagggc
cacgcttccccgggaatctacgcgcgcgccttcctcgaagggcggttgaccgccgagcaa
ctcgacggattccgccaggaacacagccatgtcggcggcgggttgccgtcctatccgcac
ccgcggctcatgcccgacttctgggaattccccaccgtgtcgatgggtttgggcccgctc
aacgccatctaccaggcacggttcaaccactatctgcatgaccgcggtatcaaagacacc
tccgatcaacacgtgtggtgttttttgggcgacggcgagatggacgaacccgagagccgt
gggctggcccacgtcggcgcgctggaaggcttggacaacttgaccttcgtgatcaactgc
aatctgcagcgactcgacggcccggtgcgcggcaacggcaagatcatccaggagctggag
tcgttcttccgcggtgccggctggaacgtcatcaaggtggtgtggggccgcgaatgggat
gccctgctgcacgccgaccgcgacggtgcgctggtgaatttaatgaatacaacacccgat
ggcgattaccagacctataaggccaacgacggcggctacgtgcgtgaccacttcttcggc
cgcgacccacgcaccaaggcgctggtggagaacatgagcgaccaggatatctggaacctc
aaacggggcggccacgattaccgcaaggtttacgccgcctaccgcgccgccgtcgaccac
aagggacagccgacggtgatcctggccaagaccatcaaaggctacgcgctgggcaagcat
ttcgaaggacgcaatgccacccaccagatgaaaaaactgaccctggaagaccttaaggag
tttcgtgacacgcagcggattccggtcagcgacgcccagcttgaagagaatccgtacctg
ccgccctactaccaccccggcctcaacgccccggagattcgttacatgctcgaccggcgc
cgggccctcgggggctttgttcccgagcgcaggaccaagtccaaagcgctgaccctgccg
ggtcgcgacatctacgcgccgctgaaaaagggctctgggcaccaggaggtggccaccacc
atggcgacggtgcgcacgttcaaagaagtgttgcgcgacaagcagatcgggccgcggata
gtcccgatcattcccgacgaggcccgcaccttcgggatggactcctggttcccgtcgcta
aagatctataaccgcaatggccagctgtataccgcggttgacgccgacctgatgctggcc
tacaaggagagcgaagtcgggcagatcctgcacgagggcatcaacgaagccgggtcggtg
ggctcgttcatcgcggccggcacctcgtatgcgacgcacaacgaaccgatgatccccatt
tacatcttctactcgatgttcggcttccagcgcaccggcgatagcttctgggccgcggcc
gaccagatggctcgagggttcgtgctcggggccaccgccgggcgcaccaccctgaccggt
gagggcctgcaacacgccgacggtcactcgttgctgctggccgccaccaacccggcggtg
gttgcctacgacccggccttcgcctacgaaatcgcctacatcgtggaaagcggactggcc
aggatgtgcggggagaacccggagaacatcttcttctacatcaccgtctacaacgagccg
tacgtgcagccgccggagccggagaacttcgatcccgagggcgtgctgcggggtatctac
cgctatcacgcggccaccgagcaacgcaccaacaaggcgcagatcctggcctccggggta
gcgatgcccgcggcgctgcgggcagcacagatgctggccgccgagtgggatgtcgccgcc
gacgtgtggtcggtgaccagttggggcgagctaaaccgcgacggggtggccatcgagacc
gagaagctccgccaccccgatcggccggcgggcgtgccctacgtgacgagagcgctggag
aatgctcggggcccggtgatcgcggtgtcggactggatgcgcgcggtccccgagcagatc
cgaccgtgggtgccgggcacatacctcacgttgggcaccgacgggttcggcttttccgac
actcggcccgccgctcgccgctacttcaacaccgacgccgaatcccaggtggtcgcggtt
ttggaggcgttggcgggcgacggcgagatcgacccatcggtgccggtcgcggccgcccgc
cagtaccggatcgacgacgtggcggctgcgcccgagcagaccacggatcccggtcccggg
gcctaa

DBGET integrated database retrieval system