KEGG   Mycobacterium tuberculosis CDC1551: MT2395Help
Entry
MT2395            CDS       T00053                                 

Definition
(GenBank) drug transporter
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_2 DUF1198
Motif
Other DBs
NCBI-ProteinID: AAK46687
UniProt: P9WG90
Position
complement(2602553..2604166)
Genome map
AA seq 537 aa AA seqDB search
MNRTQLLTLIATGLGLFMIFLDALIVNVALPDIQRSFAVGEDGLQWVVASYSLGMAVFIM
SAATLADLYGRRRWYLIGVSLFTLGSIACGLAPSIAVLTTARGAQGLGAAAVSVTSLALV
SAAFPEAKEKARAIGIWTAIASIGTTTGPTLGGLLVDQWGWRSIFYVNLPMGALVLFLTL
CYVEESCNERARRFDLSGQLLFIVAVGALVYAVIEGPQIGWTSVQTIVMLWTAAVGCALF
VWLERRSSNPMMDLTLFRDTSYALAIATICTVFFAVYGMLLLTTQFLQNVRGYTPSVTGL
MILPFSAAVAIVSPLVGHLVGRIGARVPILAGLCMLMLGLLMLIFSEHRSSALVLVGLGL
CGSGVALCLTPITTVAMTAVPAERAGMASGIMSAQRAIGSTIGFAVLGSVLAAWLSATLE
PHLERAVPDPVQRHVLAEIIIDSANPRAHVGGIVPRRHIEHRDPVAIAEEDFIEGIRVAL
LVATATLAVVFLAGWRWFPRDVHTAGSDLSERLPTAMTVECAVSHMPGATWCRLWPA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcacgcagctcctcacgctcatcgccactggcctgggcctgttcatgatcttt
ctcgacgcactgatcgtgaacgtggcgctgcccgacatccagcgcagtttcgcggtgggg
gaggacggcctgcagtgggtggtggcgtcctacagcctcggaatggcggtcttcatcatg
tcggcggcgacgcttgccgacctctacggtcggcgccgctggtacttgataggtgtttcg
ttgttcacgctgggatctatcgcctgcgggttggcgccctcaatcgcggtgctcaccacc
gcgcggggcgcgcagggcctaggtgcggcggccgtcagcgtaacctcgctcgccctggtc
agcgcggcctttccggaggcgaaggagaaggcgcgcgccatcgggatctggaccgccatc
gcgagcatcggtacgacgacgggcccgacactgggcggtctgctggtggaccagtggggg
tggcgcagcatcttctatgtcaacctgcccatgggcgcactcgtcctcttcctgactttg
tgctacgtcgaggagtcgtgtaacgagcgggcacgccgcttcgatctgtccgggcagctg
ctgttcatcgttgccgtgggtgccctggtgtatgcggtcatcgaaggcccccagatcggc
tggacgtctgtccagaccatcgtgatgctctggacagccgccgtcggctgcgccctgttc
gtctggcttgagcgcagatcatcgaatccgatgatggatctgaccctgttccgcgacacc
tcatacgccctggccatcgcgaccatctgcacggtgttcttcgccgtctatgggatgctg
ctgctcaccacccagttcctgcagaacgtgcgcggctataccccgagcgtgaccggcctg
atgatccttccgttcagtgcggccgtggccatcgtgtcgccacttgttgggcacctggtt
ggccggatcggagcacgcgttcccatcctggcggggctgtgcatgttgatgctgggtctg
ctcatgctcatcttcagcgagcaccggagctcggccctggtcctggtcgggctgggcttg
tgcgggagcggcgtcgcgttgtgcctgacgccgatcacgaccgtcgccatgaccgcggtc
cccgccgagcgtgcgggcatggcgtccggcatcatgagtgctcagcgggcgatcggctcg
acgatcgggttcgcggttttgggctccgtccttgccgcctggctttcggccacactcgag
ccccatctggagcgcgcggtgcccgacccggtccagcgccacgtccttgccgagatcatt
atcgacagtgccaatccgcgagcgcatgtgggcggaatcgtcccccggcggcacattgag
catcgcgaccccgtcgcgattgcggaggaggatttcatcgaaggcattcgggtggcgttg
ctcgtcgccactgcaacactggctgtcgtgtttctcgccggctggcgatggtttccgcgt
gacgtgcacaccgcgggcagcgacctaagcgagaggctgcctacagcgatgaccgtcgag
tgcgcggttagtcatatgccgggagccacatggtgtcgactatggcctgcctga

DBGET integrated database retrieval system