KEGG   Mycobacterium tuberculosis CDC1551: MT2408Help
Entry
MT2408            CDS       T00053                                 

Gene name
dnaG
Definition
(GenBank) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MT2408 (dnaG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mtc03032]
    MT2408 (dnaG)
Enzymes [BR:mtc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     MT2408 (dnaG)
DNA replication proteins [BR:mtc03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    MT2408 (dnaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_N zf-CHC2 DnaG_DnaB_bind DnaB_bind Toprim_4 Toprim_2 Toprim Toprim_3
Motif
Other DBs
NCBI-ProteinID: AAK46701
UniProt: P9WNW0
Structure
PDB: 

Position
complement(2616378..2618297)
Genome map
AA seq 639 aa AA seqDB search
MSGRISDRDIAAIREGARIEDVVGDYVQLRRAGADSLKGLCPFHNEKSPSFHVRPNHGHF
HCFGCGEGGDVYAFIQKIEHVSFVEAVELLADRIGHTISYTGAATSVQRDRGSRSRLLAA
NAAAAAFYAQALQSDEAAPARQYLTERSFDAAAARKFGCGFAPSGWDSLTKHLQRKGFEF
EELEAAGLSRQGRHGPMDRFHRRLLWPIRTSAGEVVGFGARRLFDDDAMEAKYVNTPETL
LYKKSSVMFGIDLAKRDIAKGHQAVVVEGYTDVMAMHLAGVTTAVASCGTAFGGEHLAML
RRLMMDDSFFRGELIYVFDGDEAGRAAALKAFDGEQKLAGQSFVAVAPDGMDPCDLRLKC
GDAALRDLVARRTPLFEFAIRAAIAEMDLDSAEGRVAALRRCVPMVGQIKDPTLRDEYAR
QLAGWVGWADVAQVIGRVRGEAKRTKHPRLGRLGSTTIARAAQRPTAGPPTELAVRPDPR
DPTLWPQREALKSALQYPALAGPVFDALTVEGFTHPEYAAVRAAIDTAGGTSAGLSGAQW
LDMVRQQTTSTVTSALISELGVEAIQVDDDKLPRYIAGVLARLQEVWLGRQIAEVKSKLQ
RMSPIEQGDEYHALFGDLVAMEAYRRSLLEQASGDDLTA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccggatctccgatcgcgatatcgcggcaatccgcgagggggcccgtatcgag
gatgtcgtcggcgactatgtccagctcaggcgtgccggtgccgattcgctgaaggggctg
tgcccgtttcacaacgagaagtccccgtcctttcacgtgcggcccaaccacggccacttc
cactgcttcggctgcggcgagggcggcgacgtgtatgcgttcatccagaagatcgagcac
gtcagcttcgtcgaggcggttgagttgcttgccgaccggatcggccacacgatcagctac
accggtgcggccaccagcgtgcagcgcgaccgcggcagtcgcagcaggctgctggccgcc
aacgcggccgcggcagcgttctatgcgcaggcgctgcagtccgacgaggcggcaccggct
cgccagtacctgaccgaacgcagcttcgacgcggcggccgctcgtaaattcggctgtggg
ttcgccccgtcgggctgggactcattgacaaaacatctgcagcgcaagggttttgagttc
gaggaactggaggccgcgggactgtcccggcagggccggcacggcccgatggaccggttt
caccgtcggctgctgtggcccatccgcacctcggccggcgaggtggtcgggttcggtgcc
cggcgactgttcgacgacgacgcgatggaggccaagtacgtcaacacgcccgagacattg
ctgtacaagaagtcatcggtgatgttcggcatcgacttggccaaacgcgacatcgccaag
ggacatcaggccgtcgtcgtcgagggctacaccgatgtcatggccatgcatctggccggg
gtcaccaccgcggtggcgtcgtgcgggaccgcattcggcggcgagcacctggcgatgctg
cgcagactgatgatggacgacagcttcttccgcggcgagctgatctacgttttcgacggc
gacgaggccggccgcgccgccgcgctcaaggccttcgacggtgagcagaagctggctggt
cagtctttcgtcgcggtggctcccgacggcatggacccctgcgacctacgactgaagtgc
ggcgacgctgccctgcgcgacctcgtggcacgacgaaccccattgttcgagttcgcgatt
cgcgccgcgattgccgagatggacctggatagcgccgagggcagggtggccgcgctgcgc
cgttgcgtaccgatggtgggccagatcaaagaccccacgctgcgtgacgaatacgcccgt
cagctcgccggctgggtcgggtgggccgacgtcgcacaggtcatcggtcgggtgcggggt
gaggccaaacgaaccaagcaccccaggctgggcagactgggatcgacgaccatcgcccgg
gcagcgcagcggcccaccgccggccccccgaccgaactcgcagtccgacctgatccgcgt
gacccgaccctgtggccacagcgtgaggcactcaaatcggcgttgcagtacccggcgttg
gccggcccggtgttcgacgcgctgaccgtcgaaggcttcacgcaccccgagtacgcggct
gtgcgcgcggccatcgacacggcgggcggtacctcggctggccttagcggtgcgcagtgg
ctggatatggtgcgccagcagacgacatcaaccgtgacctcggctttgatcagcgagctg
ggggtggaggcgattcaggtcgacgacgacaagctgccgcgctatatcgccggcgtgctg
gcccgtctgcaggaggtttggttggggcggcagatcgccgaggtgaagtccaaactgcag
cgcatgtcgccgatcgagcaaggcgacgaataccacgcgctgttcggcgacctggtcgcc
atggaggcctatcggcgcagcctgttagagcaggccagcggcgacgatctcaccgcgtga

DBGET integrated database retrieval system