KEGG   Mycobacterium tuberculosis CDC1551: MT2430
Entry
MT2430            CDS       T00053                                 

Gene name
uppS-2
Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K14215  trans,polycis-decaprenyl diphosphate synthase [EC:2.5.1.86]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00900  Terpenoid backbone biosynthesis
mtc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MT2430 (uppS-2)
Enzymes [BR:mtc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.86  trans,polycis-decaprenyl diphosphate synthase
     MT2430 (uppS-2)
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: AAK46724
UniProt: P9WFF6
Structure
PDB: 
6IME 2VG3 4ONC 2VG2 2VG4

Position
complement(2639909..2640799)
AA seq 296 aa
MARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAP
RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAF
STENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEM
TKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD
LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
NT seq 891 nt   +upstreamnt  +downstreamnt
gtggctagggatgcacggaagcggacgtccagcaacttcccgcagctgcctccggccccc
gacgactacccgacctttcctgatacgtcgacgtggcccgtcgtcttcccggagttgccg
gcagcgccctacggaggcccctgccggccaccgcagcacacttcgaaagcggccgcgcca
cgaataccggccgaccggctgcccaaccatgtcgccattgtcatggacggcaatggccgc
tgggccacccaacgtgggctggcccgcaccgaaggtcacaagatgggcgaggcggtggtg
atcgacatcgcttgcggtgctatcgaacttgggatcaagtggctcagcctctacgccttc
tccacggagaactggaagcgttcgcccgaggaagtccgcttcctgatgggcttcaaccgc
gacgtggtgcgacggcgccgagacaccctaaagaagctaggggtccggatccggtgggtg
ggttcacgaccacggctgtggcgtagcgtcatcaatgagttggcggtcgcggaggagatg
accaaaagcaacgacgtcatcaccatcaactattgcgtcaactacggcggacgcaccgaa
atcaccgaagccacccgcgaaatcgctcgtgaggtcgccgcgggcaggctcaacccggag
cggatcaccgaatccacgatcgcccgccacctgcagcgacccgacattcccgacgttgac
ctcttcctgcggacctcgggtgagcagcgctccagcaacttcatgctgtggcaggcggcc
tacgctgaatacatattccaggacaagctctggcccgactatgaccgccgcgacttgtgg
gcggcctgcgaggaatacgcgtcgcgcactcggcggttcgggagcgcctag

DBGET integrated database retrieval system