KEGG   Mycobacterium tuberculosis CDC1551: MT2445.1
Entry
MT2445.1          CDS       T00053                                 

Gene name
mbtH
Definition
(GenBank) mbtH protein
  KO
K05375  MbtH protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00261  Monobactam biosynthesis
mtc01100  Metabolic pathways
mtc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    MT2445.1 (mbtH)
SSDB
Motif
Pfam: MbtH
Other DBs
NCBI-ProteinID: AAK46740
UniProt: P9WIP4
Structure
PDB: 
2KHR

Position
complement(2653546..2653761)
AA seq 71 aa
MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR
PKSLRDAMAED
NT seq 216 nt   +upstreamnt  +downstreamnt
gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa
gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac
ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg
ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system