KEGG   Mycobacterium tuberculosis CDC1551: MT2462
Entry
MT2462            CDS       T00053                                 

Gene name
cysH
Definition
(GenBank) phosphoadenosine phosphosulfate reductase
  KO
K00390  phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00920  Sulfur metabolism
mtc01100  Metabolic pathways
mtc01120  Microbial metabolism in diverse environments
Module
mtc_M00176  Assimilatory sulfate reduction, sulfate => H2S
mtc_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MT2462 (cysH)
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     MT2462 (cysH)
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     MT2462 (cysH)
SSDB
Motif
Pfam: PAPS_reduct
Other DBs
NCBI-ProteinID: AAK46757
UniProt: P9WIK2
Position
2683698..2684462
AA seq 254 aa
MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAGGGVSGHRGWTTCN
YVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESVYDVRVLNVTPEHT
VAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGYSAWVTGLRRVDAPTRANAPLVSFD
ETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLVREGYPSIGCAPCTAKPAEGADPRSGR
WQGLAKTECGLHAS
NT seq 765 nt   +upstreamnt  +downstreamnt
atgagcggcgagacaaccaggctgaccgaaccgcaactacgtgagctggccgcgcgcgga
gctgccgaactcgacggcgccaccgccaccgacatgttgcgctggaccgacgaaaccttc
ggcgacatcggcggcgccggcggcggcgtgagcggacatcgcgggtggacaacgtgcaac
tacgtagttgcttccaacatggctgatgcggtgctggtggatctggccgccaaggtgcga
ccgggcgtaccggtcatctttcttgataccggctaccacttcgtcgaaacaatcggcacc
agagatgcgatcgagtccgtctatgacgtccgggtgctcaatgtcactccggagcacaca
gtggccgagcaggacgaactgctgggcaaggacttgttcgcccgcaacccccatgaatgc
tgccggttgcgcaaggtcgttcccctgggcaagacgctgcgtggctactccgcgtgggtg
accgggctacggcgggtcgatgcaccgacccgggccaatgccccgctggtcagcttcgat
gagacgttcaaactagtgaaggtcaacccgctggcggcgtggaccgaccaagatgtgcag
gaatacattgccgacaacgacgtgctggttaatccgcttgtgcgggaaggctatccgtcg
atcggttgcgctccgtgcacagccaaacccgccgaaggcgccgacccgcgcagcggacgc
tggcaggggctggccaagaccgaatgcgggttgcacgcctcgtga

DBGET integrated database retrieval system