KEGG   Mycobacterium tuberculosis CDC1551: MT2468
Entry
MT2468            CDS       T00053                                 
Symbol
cysA
Name
(GenBank) sulfate ABC transporter, ATP-binding protein
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00920  Sulfur metabolism
mtc02010  ABC transporters
Module
mtc_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MT2468 (cysA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MT2468 (cysA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtc02000]
    MT2468 (cysA)
Enzymes [BR:mtc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     MT2468 (cysA)
Transporters [BR:mtc02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    MT2468 (cysA)
SSDB
Motif
Pfam: ABC_tran TOBE_3 AAA_21 TOBE SMC_N TOBE_2 AAA_22 TniB AAA_16 AAA_29 RsgA_GTPase AAA_23 AAA_25 SbcC_Walker_B NACHT AAA AAA_30 AAA_33 AAA_27 MMR_HSR1 AAA_24
Other DBs
NCBI-ProteinID: AAK46764
UniProt: P9WQM0
Position
complement(2691240..2692301)
AA seq 353 aa
MKMTYAIVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDT
GTITINGRDVTRVPPQRRGIGFVFQHYAAFKHLTVRDNVAFGLKIRKRPKAEIKAKVDNL
LQVVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDEPFGALDAKVREELRAWLR
RLHDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAV
STLNGSLVRPHDIRVGRTPNMAVAAADGTAGSTGVLRAVVDRVVVLGFEVRVELTSAATG
GAFTAQITRGDAEALALREGDTVYVRATRVPPIAGGVSGVDDAGVERVKVTST
NT seq 1062 nt   +upstreamnt  +downstreamnt
gtgaaaatgacctacgccatcgtcgtggccgacgccaccaaacgctacggcgacttcgtc
gcacttgaccacgtggatttcgtcgtaccgaccggttcgctgaccgcattgttgggcccc
agcggttcgggcaagtcgacgctgttgcgcaccatagccggcctcgaccaaccggacacc
ggaaccatcacgatcaacggccgcgacgtcacccgggtgccgccacagcggcgtggcatc
ggattcgtcttccagcactacgcggcgttcaaacacctgactgtccgtgacaacgtggcg
ttcgggttgaagatccgtaagcgccccaaggccgagatcaaggccaaggtcgacaatctg
ctgcaggtggtgggcctgagcggatttcagagccgctaccccaatcagctctccggtggg
caacgacagcggatggcgctggccagggcgctggcggtcgatccggaggtgctgctgctc
gacgagccgttcggcgcactcgatgccaaggtgcgcgaagagctgcgtgcctggctgcgc
cgcctgcacgacgaggtgcatgtcaccacggtgctggtcacccacgatcaggccgaagcg
ctggatgtggccgaccgcatcgccgtactccacaagggccgtatcgagcaggtcggatcc
ccgaccgacgtttacgacgccccggcgaacgccttcgtgatgtccttcttgggagcggtt
tccacgttgaacggctccctggtgcgcccgcacgacatccgggtcggccggactcccaat
atggccgtggccgccgctgacggcaccgccgggtccaccggtgtgctacgggctgttgtg
gatcgggtggtggtgctgggcttcgaggtccgcgtggagttgaccagcgcggccaccggc
ggggccttcaccgcccagatcacccgcggcgatgccgaggcgctggccctacgcgagggt
gacaccgtctacgtgcgtgccacccgggtgccgccgattgccggtggcgtatcgggcgtc
gacgatgccggcgtggaacgggtcaaagtcacatcgacgtga

DBGET integrated database retrieval system