KEGG   Mycobacterium tuberculosis CDC1551: MT2470
Entry
MT2470            CDS       T00053                                 

Gene name
cysU
Definition
(GenBank) sulfate ABC transporter, permease protein
  KO
K02046  sulfate/thiosulfate transport system permease protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00920  Sulfur metabolism
mtc02010  ABC transporters
Module
mtc_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MT2470 (cysU)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MT2470 (cysU)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtc02000]
    MT2470 (cysU)
Transporters [BR:mtc02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    MT2470 (cysU)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AAK46766
UniProt: L7N5T2
Position
complement(2693127..2693978)
AA seq 283 aa
MTESLVGERRAPQFRARLSGPAGPPSVRVGMAVVWLSVIVLLPLAAIVWQAAGGGWRAFW
LAVSSHAAMESFRVTLTISTAVTVINLVFGLLIAWVLVRDDFAGKRIVDAIIDLPFALPT
IVASLVMLALYGNNSPVGLHFQHTATGVGVALAFVTLPFVVRAVQPVLLEIDRETEEAAA
SLGANGAKIFTSVVLPSLTPALLSGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWIRT
LIENDDRTGAAAISVVLLSISFIVLLILRVVGARAAKREEMAA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgacggaatcgttggtcggcgaacgccgcgcgccgcagttccgcgcgcgcctttccggc
cccgcgggccccccttccgttcgggtcggtatggcagtggtgtggctttcggtgatcgtg
ctgttgccgctggccgccatcgtctggcaggccgcgggcggtggttggcgggccttctgg
ctggcggtctcgtcgcatgccgcgatggagtcgttccgggtaacgctgacgatttcgacc
gcagtcacggtcatcaacctggtgttcggcttgctgatcgcctgggtgctggtgcgtgac
gacttcgctggcaagcggatcgtcgatgcgattatcgatctgccgtttgcgttgcccacc
atcgtcgccagcctggtgatgttggcactgtacgggaacaacagcccggtggggcttcat
tttcaacacaccgcgaccggtgttggggtggcgttggcgttcgtcacattgccgttcgtg
gtgcgcgccgtgcagccggtgctgctggaaatcgatcgcgagaccgaggaggcggcggcg
tcgctgggcgctaatggtgccaaaatcttcacttcggtggtgttgccgtcgctgacgccg
gcattgttatccggtgcgggcctggcgttttcgcgcgctatcggcgagttcggttcggtg
gttctgatcggcggggccgtgccgggcaagaccgaggtgtcctcgcaatggattcgcacc
ctgatcgagaacgacgaccgcaccggagcggccgcgatatcggttgtattgctctcgatt
tcgttcattgtgctgctcatcctacgtgtcgtcggcgcgcgtgcggccaaacgtgaggag
atggccgcatga

DBGET integrated database retrieval system