KEGG   Mycobacterium tuberculosis CDC1551: MT2508
Entry
MT2508            CDS       T00053                                 

Definition
(GenBank) cyclic nucleotide-binding protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Motif
Pfam: MS_channel cNMP_binding
Other DBs
NCBI-ProteinID: AAK46805
UniProt: L7N4B4
Position
complement(2725965..2727410)
AA seq 481 aa
MNLLDSTWFYWAVGIAIGLPAGLIVLTELHNILVRRNSHLARQASLLRNYLLPLGAVLLL
LVKASEVPAEDPTVRVLTTAFGFLVLVLLLSLLNATLFQGAPQQSWRKRLPAIFVDVARF
ALIGIGLAVILSYIWGVRVGGLFAALGVTSVVIGLMLQNSVGQIVSGLFMLFEQPFRIDD
WLETPTARGRVVEVNWRAVHIDTGSGLQIMPNSMLATTAFTNLSRPAGAHECSITTTFST
SDPPDKVCAMLNRAASALPHVKPGVVPATIARGAAEYRTTVRLTSPADEGPTQATFLRWV
WYAARREGLHLDEADDEFSTAERVESALRTVVGPELRLSSSDQQSLARYARLVRYGTDEI
VQHAGVVPMGITFVIAGSVRLTVTTDDGSVVAIATLKKGTFLGLTALTRQPDPAGAVALE
EVTALQIGREHLEQVVMNKPMLLQELGRVIDERQRKAQQAIRRDLHQSPAAAGEHRGPAR
R
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacctgctcgactcgacatggttctactgggccgttggcattgcgatcggattgccg
gccgggctaatcgttctcaccgaactgcacaacatactcgtccgacggaacagccatctg
gccaggcaggcaagtctgctgcgaaactacctgctacccctgggcgcggttttgctgctg
cttgtcaaggcatctgaagtcccggccgaggaccccaccgtgcgggtgctcacgacagcg
ttcggatttctggtgctggtgctgctgctgtcgttactgaatgccaccctgtttcagggt
gcgccccaacagagctggcgcaagcggctacccgccatcttcgtcgatgtcgcgcgcttc
gcgctgatcggcataggtttggcggtgatcctgtcctacatctggggggtgcgggtcggt
ggactgttcgccgcgttaggtgtgacgtcagtcgtcatcggcctgatgctgcagaactcc
gtcggccagatcgtgtcgggcttgttcatgctgttcgaacagccctttcggatcgatgat
tggttggaaacacccacagcccgcggacgagtcgtcgaggtgaactggcgggctgtccat
atcgacaccggcagcggactgcagatcatgcccaactcgatgttggccaccaccgcgttt
accaatctcagccggccggccggggcgcacgaatgctcgatcacgaccacattttccacg
tccgatcccccggacaaggtatgcgccatgctgaacagggctgccagcgcgctaccgcat
gttaagcccggggtcgtgcccgccacaattgcccgaggagccgccgagtatcgaacgacg
gtcaggctgacatcaccggccgacgaaggcccaacgcaggcaacgtttctgcgctgggtc
tggtacgccgcgcgtcgggaagggctacacctcgacgaggccgacgacgagttctcgacg
gccgaacgtgtggagtccgccctgcgcacggtggtggggcccgagctgcgactgagctct
agcgatcagcagtcgctggctcggtacgcgaggctggtgcgctacggcactgatgagatc
gtgcagcacgcgggtgtggttcccatgggtatcaccttcgtgatcgccggcagcgtgcgg
ctgacggttacgaccgatgacggatccgtggttgcgattgccaccctcaaaaagggcacg
tttctgggcttgactgcgctgactcggcaacccgaccccgccggtgcggtagcgctggaa
gaggtgaccgcgctgcagatcggccgggagcaccttgagcaggtcgtgatgaacaagccg
atgctgctgcaggagctgggtcgggttatcgacgagcggcaaaggaaggcgcaacaggca
attcgccgcgacttgcaccaatccccagcggcggccggcgagcatcgtgggcctgcgcga
cgctga

DBGET integrated database retrieval system