KEGG   Mycobacterium tuberculosis CDC1551: MT2531
Entry
MT2531            CDS       T00053                                 

Name
(GenBank) conserved hypothetical protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Motif
Pfam: MFS_1 MFS_1_like
Other DBs
NCBI-ProteinID: AAK46831
UniProt: P9WJX0
Position
complement(2753782..2755038)
AA seq 418 aa
MSGTVVAVPPRVARALDLLNFSLADVRDGLGPYLSIYLLLIHDWDQASIGFVMAVGGIAA
IVAQTPIGALVDRTTAKRALVVAGAVLVTAAAVAMPLFAGLYSISVLQAVTGIASSVFAP
ALAAITLGAVGPQFFARRIGRNEAFNHAGNASAAGATGALAYFFGPVVVFWVLAGMALIS
VLATLRIPPDAVDHDLARGMDHAPGEPHPQPSRFTVLAHNRELVIFGAAVVAFHFANAAM
LPLVGELLALHNRDEGTALMSSCIVAAQVVMVPVAYVVGTRADAWGRKPIFLVGFAVLTA
RGFLYTLSDNSYWLVGVQLLDGIGAGIFGALFPLVVQDVTHGTGHFNISLGAVTTATGIG
AALSNLVAGWIVVVAGYDAAFMSLGALAGAGFLLYLVAMPETVDSDVRVRSRPTLGGK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtcgggcaccgttgtggcagtgccgccacgggtggcgcgtgcgctggacctgctgaat
ttctcgttggctgatgttcgcgacggtctgggcccctatctgtcgatatacctcctgttg
atccacgattgggatcaagcctcgatcgggttcgtcatggcggtcggcggcattgcggcc
atcgtggcccagacgccgattggcgccctggtggaccggaccacggccaagcgggcgctg
gtcgtcgccggcgcggtgctggtcaccgccgccgcagtggcgatgccgctgtttgcgggc
ttgtattccatctcggtgctgcaggccgtcaccgggatcgccagctcggttttcgctccg
gcgttggcggcgatcacgttgggtgctgtcggtcctcagtttttcgccagacggattggg
cgtaacgaagcgttcaaccacgccggtaacgcgtcggcggctggggcgaccggcgcgctg
gcgtacttcttcgggccggtggtggtgttctgggtgctggccggcatggcgttgatcagc
gtgctggcgacactgcggatcccgccggacgcggtcgaccacgatttagcgcgtggtatg
gaccatgcgcccggcgagccgcatccgcagccgtcgcggttcaccgtgttggcgcacaac
cgcgaactggtgatcttcggggcggcggttgtcgcgttccacttcgccaacgcggcgatg
ctgccgctggtcggcgagctgttggcgttgcacaatcgagacgaaggaacggcgctgatg
tcgtcgtgcatcgtcgcggcgcaggtcgtgatggtgccggtggcgtatgtggtcgggacc
agggccgacgcgtgggggcgaaagccgatctttttggtggggttcgctgtcttgaccgct
cgcgggttcctctacacgttgtcggataactcctactggctggtgggcgtgcagttgctc
gacggtatcggagccggcattttcggggcgttgtttccccttgtcgtacaggacgtcaca
cacggaacgggacatttcaatatcagcctcggggcggtaaccacggcaacgggcattggt
gccgcgctgtctaatcttgttgccggctggatcgtggtcgtcgcgggctatgacgcggca
ttcatgtcgctgggtgcgctcgccggggccggcttcctcctgtacctggtcgcgatgccg
gaaaccgtggattcggatgtccgggtgcggtcgcggccaaccctcggggggaagtga

DBGET integrated database retrieval system