KEGG   Mycobacterium tuberculosis CDC1551: MT2922
Entry
MT2922            CDS       T00053                                 

Definition
(GenBank) oxidoreductase, pyridine nucleotide-disulphide family, class I
  KO
K17883  mycothione reductase [EC:1.8.1.15]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MT2922
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.15  mycothione reductase
     MT2922
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 K_oxygenase NAD_binding_9 PP_kinase_C 3HCDH_N
Other DBs
NCBI-ProteinID: AAK47247
UniProt: P9WHH2
Position
3159415..3160794
AA seq 459 aa
METYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTI
RGASRYGIDAHIDRVRWDDVVSRVFGRIDPIALSGEDYRRCAPNIDVYRTHTRFGPVQAD
GRYLLRTDAGEEFTAEQVVIAAGSRPVIPPAILASGVDYHTSDTVMRIAELPEHIVIVGS
GFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNVVDGQQ
RGSGVALRLDDGCTINADLLLVATGRVSNADLLDAEQAGVDVEDGRVIVDEYQRTSARGV
FALGDVSSPYLLKHVANHEARVVQHNLLCDWEDTQSMIVTDHRYVPAAVFTDPQIAAVGL
TENQAVAKGLDISVKIQDYGDVAYGWAMEDTSGIVKLITERGSGRLLGAHIMGYQASSLI
QPLIQAMSFGLTAAEMARGQYWIHPALPEVVENALLGLR
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggaaacgtacgacatcgcgatcatcggaaccggttcgggcaacagcattctcgacgaa
cgctatgccagcaagcgggcggcgatctgcgagcagggcaccttcggcggcacctgcctc
aatgtcgggtgcatccccacaaaaatgttcgtctacgccgccgaggtggccaagaccatc
cgaggcgcgtcgcgttacggtatcgacgcgcacatcgaccgggtgcgatgggacgacgtc
gtctcgcgcgtcttcgggcgcatcgatccgatcgcgctgagcggcgaggactatcgaagg
tgtgcgcccaacatcgacgtgtaccgcacacacacccgtttcgggccggttcaggccgat
ggccgctacctgttgcgcactgacgcgggtgaagagttcaccgccgagcaggtggtgata
gccgccggatcgcggccggtgattccgccggccatcctcgcgtccggcgtcgactatcac
accagcgataccgtcatgcggatcgccgagttgccggagcacatcgtgatcgtcggaagc
ggcttcattgcagcggaattcgcacatgtgttttccgctctgggcgtacgggtcaccctg
gtgatccggggcagctgcttactacggcattgtgacgacaccatctgcgaacggttcacc
cgcatcgcatcgaccaaatgggagctgcgcacccatcgcaacgttgtggacggccagcag
cgcggctcgggcgtcgcgctgcggctagacgatggttgcaccatcaacgccgacctactg
ttggtagcgacaggccgggtgtccaacgccgacctgctggatgccgagcaggccggtgtc
gatgtcgaggacggccgggtgatagtcgacgagtaccaacggacttcggcgcgtggggtt
tttgcgctgggcgatgtctcgtcgccgtacttgctcaagcatgtcgccaaccacgaggcc
cgcgtcgtgcagcacaatctgctctgcgactgggaggacacccagtcgatgatcgtcacc
gaccaccgatacgtaccggctgcggtattcaccgatcctcagatcgctgccgtcggactc
actgaaaaccaagctgtggcaaagggactcgatatttcggtcaagatacaggactatggt
gacgtcgcgtacggctgggcgatggaggacaccagtggaatcgtcaagctcatcaccgag
cgcggctctgggcgcttactgggcgcacacatcatgggttaccaggcatcctcgctcatc
caaccgttgatccaggcgatgagctttgggctgaccgccgccgaaatggcccgcggccag
tactggattcatccggcgctgccggaggtggtggaaaacgcgctgcttggcctgcgttga

DBGET integrated database retrieval system