KEGG   Mycobacterium tuberculosis CDC1551: MT2999
Entry
MT2999            CDS       T00053                                 

Definition
(GenBank) acyl-CoA synthase
  KO
K12426  long-chain fatty acid adenylase/transferase FadD26 [EC:6.2.1.59]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtc01004]
    MT2999
Enzymes [BR:mtc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.59  long-chain fatty acid adenylase/transferase FadD26
     MT2999
Lipid biosynthesis proteins [BR:mtc01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   MT2999
SSDB
Motif
Pfam: AMP-binding AMP-binding_C_2
Other DBs
NCBI-ProteinID: AAK47327
UniProt: P9WQ42
Position
3238018..3239769
AA seq 583 aa
MPVTDRSVPSLLQERADQQPDSTAYTYIDYGSDPKGFADSLTWSQVYSRACIIAEELKLC
GLPGDRVAVLAPQGLEYVLAFLGALQAGFIAVPLSTPQYGIHDDRVSAVLQDSKPVAILT
TSSVVGDVTKYAASHDGQPAPVVVEVDLLDLDSPRQMPAFSRQHTGAAYLQYTSGSTRTP
AGVIVSHTNVIANVTQSMYGYFGDPAKIPTGTVVSWLPLYHDMGLILGICAPLVARRRAM
LMSPMSFLRRPARWMQLLATSGRCFSAAPNFAFELAVRRTSDQDMAGLDLRDVVGIVSGS
ERIHVATVRRFIERFAPYNLSPTAIRPSYGLAEATLYVAAPEAGAAPKTVRFDYEQLTAG
QARPCGTDGSVGTELISYGSPDPSSVRIVNPETMVENPPGVVGEIWVHGDHVTMGYWQKP
KQTAQVFDAKLVDPAPAAPEGPWLRTGDLGVISDGELFIMGRIKDLLIVDGRNHYPDDIE
ATIQEITGGRAAAIAVPDDITEQLVAIIEFKRRGSTAEEVMLKLRSVKREVTSAISKSHS
LRVADLVLVSPGSIPITTSGKIRRSACVERYRSDGFKRLDVAV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgccggtgaccgaccgttcagtgccctctttgctgcaagagagggccgaccagcagcct
gacagcactgcatatacgtacatcgactacggatccgaccccaagggatttgctgacagc
ttgacttggtcgcaggtctacagtcgtgcatgcatcattgctgaagaactcaagttatgc
gggttacccggagatcgagtggcggttttagcgccacaaggactggaatatgtccttgca
ttcctgggcgcacttcaggctggatttatcgcggttccgctgtcaactccacagtatggc
attcacgatgaccgcgtttctgcggtgttgcaggattccaagccggtagccattctcacg
acttcgtccgtggtaggcgatgtaacgaaatacgcagccagccacgacgggcagcctgcc
ccggtcgtagttgaggttgatctgcttgatttggactcgccgcgacagatgccggctttc
tctcgtcagcacaccggggcggcttatctccaatacacgtccggatcgacgcgtacgccg
gccggagtcattgtgtcgcacacgaatgtcattgccaatgtgacacaaagtatgtacggc
tatttcggcgatcccgcaaagattccgaccgggactgtggtgtcgtggctgcctttgtat
cacgatatgggcctgattctcggaatttgcgcaccgctggtggcccgacgccgcgcgatg
ttgatgagcccaatgtcatttttgcgccgtccggcccgctggatgcaactgcttgccacc
agcggccggtgcttttctgcggcaccgaatttcgccttcgagctggccgtgcgcagaaca
tctgaccaggacatggcggggctcgacctgcgcgacgtggtcggcatcgtcagtggcagt
gagcgaatccatgtggcaaccgtgcggcggttcatcgagcggttcgcgccgtacaatctc
agccccaccgcgatacggccgtcgtacgggctcgcggaagcgaccttatatgtggcagct
cccgaagccggcgccgcgcccaagacggtccgttttgactacgagcagctgaccgccggg
caggctcggccctgcggaaccgatgggtcggtcggcaccgaactgatcagctacggctcc
cccgacccatcgtctgtgcgaatcgtcaacccggagaccatggttgagaatccgcctgga
gtggtcggtgagatctgggtgcatggcgaccacgtgactatggggtattggcagaagccg
aagcagaccgcgcaggtcttcgacgccaagctggtcgatcccgcgccggcagccccggag
gggccgtggctgcgcaccggcgacctgggcgtcatttccgatggtgagctgttcatcatg
ggccgcatcaaagacctgctcatcgtggacgggcgcaaccactaccccgacgacatcgag
gcaacgatccaggagatcaccggtggacgggccgcggcgatcgcagtgcccgacgacatc
accgaacaactggtggcgatcatcgaattcaagcgacgcggtagtaccgccgaagaggtc
atgctcaagctccgctcggtgaagcgtgaggtcacctccgcgatatcgaagtcacacagc
ctgcgggtggccgatctcgttctggtgtcacctggttcgattcccatcaccaccagcggc
aagatccggcggtcagcctgcgtcgaacgctatcgcagcgacggcttcaagcggctggac
gtagccgtatga

DBGET integrated database retrieval system