KEGG   Mycobacterium tuberculosis CDC1551: MT3649Help
Entry
MT3649            CDS       T00053                                 

Definition
(GenBank) P450 heme-thiolate protein
  KO
K15981  cholest-4-en-3-one 26-monooxygenase [EC:1.14.15.29]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00984  Steroid degradation
mtc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MT3649
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mtc00199]
    MT3649
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.29  cholest-4-en-3-one 26-monooxygenase [(25S)-3-oxocholest-4-en-26-oate forming]
     MT3649
Cytochrome P450 [BR:mtc00199]
 Cytochrome P450, bacteria type
  CYP125 family
   MT3649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AAK48008
UniProt: P9WPP0
Structure
PDB: 

Position
complement(3976287..3977588)
Genome map
AA seq 433 aa AA seqDB search
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPG
KGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMD
APHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIA
GLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIV
TQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPE
TAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNIL
RNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKH
WQVDYTGRCPVAH
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtggaatcaccagtcagtggagattgcagtaaggagaactaccgtgcccagcccc
aatctgccgcccgggttcgatttcaccgaccccgcaatctacgccgaacggctgccggtt
gccgaattcgccgagctgcggtccgcggcgccgatctggtggaacgggcaggatcctggc
aagggcggcggctttcacgacggcggtttctgggcgatcaccaaactcaacgacgtcaaa
gagatatcgcggcatagcgacgtgttctccagctacgaaaacggggtgatcccgcgattc
aagaacgacatcgcgcgtgaggacatcgaggttcagcgcttcgtcatgctcaacatggac
gcgccgcaccacacccggctgcgcaagatcatctctcgcggcttcacgccacgtgcggtc
ggacgcctgcatgacgagctccaggagcgcgcccagaagatcgccgcggaggcggccgcc
gcgggttctggagactttgtcgagcaggtttcctgtgagctgccattgcaggcgatcgcg
ggcttgctgggcgtgccgcaggaggaccgcggcaagctgttccactggtcaaacgagatg
accggcaacgaggatccggaatacgcccacatcgatccgaaggcgtcctcggcggagctg
atcggctatgcgatgaagatggccgaggagaaggcgaagaaccccgccgacgacatcgtg
actcagttgatccaagccgatatcgacggcgagaagctctccgacgacgagttcggcttc
ttcgtggtgatgctggcggtggccggtaacgagaccacccgcaactccatcacccagggc
atgatggcgttcgctgaacaccccgaccagtgggagctgtacaagaaagtgcgtccggag
accgcggccgatgagatcgtgcgctgggcaaccccggtcaccgcttttcagcgcaccgcg
ctgcgggactacgagttgtccggcgtacagattaagaagggtcagcgggtggtgatgttc
taccggtcggctaacttcgacgaagaggttttccaggatccgttcacatttaacatcctg
cgcaaccccaacccgcacgtcggcttcggcggcaccggcgctcactactgcatcggtgcg
aatctggcccggatgacgatcaacctaatctttaacgccgtagccgaccacatgcccgac
ctcaagccgatctcggcgcccgagcggctgcggtccggctggctcaacggcattaagcac
tggcaggtcgactacaccggtagatgcccggttgctcactaa

DBGET integrated database retrieval system