KEGG   Mycobacterium tuberculosis CDC1551: MT3910
Entry
MT3910            CDS       T00053                                 

Symbol
mpb51
Name
(GenBank) esterase, putative
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Motif
Pfam: Esterase Peptidase_S9
Other DBs
NCBI-ProteinID: AAK48276
UniProt: P9WQN6
Position
complement(4256886..4257818)
AA seq 310 aa
MHTALHDGGGHMKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRD
IPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWE
QDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMS
GFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVW
SPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGA
MSGDIVGAIR
NT seq 933 nt   +upstreamnt  +downstreamnt
gtgcacacagccttacacgacggaggtggacacatgaagggtcggtcggcgctgctgcgg
gcgctctggattgccgcactgtcattcgggttgggcggtgtcgcggtagccgcggaaccc
accgccaaggccgccccatacgagaacctgatggtgccgtcgccctcgatgggccgggac
atcccggtggccttcctagccggtgggccgcacgcggtgtatctgctggacgccttcaac
gccggcccggatgtcagtaactgggtcaccgcgggtaacgcgatgaacacgttggcgggc
aaggggatttcggtggtggcaccggccggtggtgcgtacagcatgtacaccaactgggag
caggatggcagcaagcagtgggacaccttcttgtccgctgagctgcccgactggctggcc
gctaaccggggcttggcccccggtggccatgcggccgttggcgccgctcagggcggttac
ggggcgatggcgctggcggccttccaccccgaccgcttcggcttcgctggctcgatgtcg
ggctttttgtacccgtcgaacaccaccaccaacggtgcgatcgcggcgggcatgcagcaa
ttcggcggtgtggacaccaacggaatgtggggagcaccacagctgggtcggtggaagtgg
cacgacccgtgggtgcatgccagcctgctggcgcaaaacaacacccgggtgtgggtgtgg
agcccgaccaacccgggagccagcgatcccgccgccatgatcggccaagccgccgaggcg
atgggtaacagccgcatgttctacaaccagtatcgcagcgtcggcgggcacaacggacac
ttcgacttcccagccagcggtgacaacggctggggctcgtgggcgccccagctgggcgct
atgtcgggcgatatcgtcggtgcgatccgctaa

DBGET integrated database retrieval system