KEGG   Mycobacterium tuberculosis CDC1551: MT3931Help
Entry
MT3931            CDS       T00053                                 

Definition
(GenBank) membrane protein, MmpL family
  KO
K06994  putative drug exporter of the RND superfamily
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    MT3931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL Sterol-sensing PhageMin_Tail
Motif
Other DBs
NCBI-ProteinID: AAK48298
UniProt: P9WJU4
Position
complement(4280583..4283852)
Genome map
AA seq 1089 aa AA seqDB search
MCDVLMQPVRTPRPSTNLRSKPLRPTGDGGVFPRLGRLIVRRPWVVIAFWVALAGLLAPT
VPSLDAISQRHPVAILPSDAPVLVSTRQMTAAFREAGLQSVAVVVLSDAKGLGAADERSY
KELVDALRRDTRDVVMLQDFVTTPPLRELMTSKDNQAWILPVGLPGDLGSTQSKQAYARV
ADIVEHQVAGSTLTANLTGPAATVADLNLTGQRDRSRIEFAITILLLVILLIIYGNPITM
VLPLITIGMSVVVAQRLVAIAGLAGLGIANQSIIFMSGMMVGAGTDYAVFLISRYHDYLR
QGADSDQAVKKALTSIGKVIAASAATVAITFLGMVFTQLGILKTVGPMLGISVAVVFFAA
VTLLPALMVLTGRRGWIAPRRDLTRRFWRSSGVHIVRRPKTHLLASALVLVILAGCAGLA
RYNYDDRKTLPASVESSIGYAALDKHFPSNLIIPEYLFIQSSTDLRTPKALADLEQMVQR
VSQVPGVAMVRGITRPAGRSLEQARTSWQAGEVGSKLDEGSKQIAVHTGDIDKLAGGANL
MASKLGDVRAQVNRAISTVGGLIDALAYLQDLLGGNRVLGELEGAEKLIGSMRALGDTID
ADASFVANNTEWASPVLGALDSSPMCTADPACASARTELQRLVTARDDGTLAKISELARQ
LQATRAVQTLAATVSGLRGALATVIRAMGSLGMSSPGGVRSKINLVNKGVNDLADGSRQL
AEGVQLLVDQVKKMGFGLGEASAFLLAMKDTATTPAMAGFYIPPELLSYATGESVKAETM
PSEYRDLLGGLNVDQLKKVAAAFISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGA
QPNTALADAKVSVVGLPVVLKDTRDYSDHDLRLIIAMTVCIVLLILIVLLRAIVAPLYLI
GSVIVSYLAALGIGVIVFQFLLGQEMHWSIPGLTFVILVAVGADYNMLLISRLREEAVLG
VRSGVIRTVASTGGVITAAGLIMAASMYGLVFASLGSVVQGAFVLGTGLLLDTFLVRTVT
VPAIAVLVGQANWWLPSSWRPATWWPLGRRRGRAQRTKRKPLLPKEEEEQSPPDDDDLIG
LWLHDGLRL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacgtcttgatgcagcctgtcagaacaccgagaccctcgacgaacttacgatcg
aaaccgcttaggccaaccggtgacgggggtgtctttccgcggctagggcgccttatcgtc
cgaaggccgtgggtggtgatcgccttctgggtcgcgcttgcgggtctgcttgcgccgacg
gtgccgtccctggacgcgatctcccagcggcatccagtggcgattctgccatcggacgcc
ccggtgttggtctcgacccggcagatgaccgcggcatttcgtgaagccgggttgcagagc
gttgcggtggtggtgctcagcgatgccaaagggctcggcgcggccgatgaacgcagctac
aaagagctggttgacgccctgcgacgcgatactcgagacgtcgtgatgctccaggacttc
gtcaccacaccgcccctgcgggagctcatgaccagcaaagacaatcaggcctggatcctg
ccggtcggccttcccggcgacctgggttcgacccagtccaagcaggcgtacgcccgcgtc
gctgacatcgtcgaacaccaggtcgcaggctcgacactgacggctaacctgaccgggccc
gcggccaccgtcgccgatctgaacctcaccgggcaacgggaccgcagtcgcatcgagttt
gcgatcacgatcctgttgttggtcattttgctgatcatctacgggaatccgatcaccatg
gtgttgccattgataacaattggcatgtccgtggtggttgcacagcgcctcgttgcaata
gccggcttggcgggcctcggtattgctaaccagagcattatttttatgagcgggatgatg
gtcggtgcgggaacggattacgcggtatttctgattagtcgatatcacgactatttacgg
cagggcgcggattcggatcaagccgtcaagaaggcattgacatccatcggtaaggtgatc
gccgcctccgcggctaccgtagcaatcacctttctcgggatggtgtttacccaactggga
attctcaaaacggttggtccgatgttgggaatctcggtagccgtggtcttcttcgcagct
gtcacactgctacccgccctgatggtgctgaccgggcgtcgcggttggatcgcgccgcgc
cgtgacctcacccggcgcttttggcggagttcgggggtgcacatcgtgcgtcggcccaag
actcatctgctcgccagcgcgctggtgctggttattctggccggctgcgcaggactggcc
cggtacaactacgacgatcgcaagacgcttccggcttccgtcgagagttcgatcgggtat
gccgcgttggacaagcatttcccgtctaacctgatcattcccgagtacctgttcatccaa
tcctcgacggatctgcgcacgccgaaggctctcgccgacctagagcagatggtgcagcgg
gtgagccaagtgccgggtgtcgcgatggtcaggggcattacccgacccgctggacggtcg
ctggagcaggcccggacgtcctggcaggctggcgaagtcggcagcaagctggatgagggt
tccaagcagatcgctgtgcacaccggcgacatcgacaaactggccggtggagccaacctg
atggcgagcaaactcggcgacgtacgggcccaagttaaccgggccatatccacggtcggc
ggcctcatcgacgcgctggcgtaccttcaggacctgctcgggggcaacagggttctcggc
gaactggaaggcgcggagaagctgatcggcagcatgcgggcactcggtgacaccattgac
gcggatgcgagctttgtagcgaacaacaccgagtgggcaagcccggtgctgggggcgctg
gatagcagcccgatgtgcactgccgatccggcttgtgccagtgcgcgcaccgaactgcag
cgtttggtcacagcgcgcgacgacggaacgctggcaaagatatctgagttggctcgacag
ctgcaggccacgcgcgcagtgcagaccctggcagccaccgtgtccggattacgcggggcg
ctggccaccgtcatcagggcgatgggttcactggggatgagcagtcctggtggtgtgcga
tccaagatcaacctggtgaacaagggggtcaatgatctcgccgacgggagccggcaactg
gctgagggcgtgcagttgttggtcgaccaggtgaagaagatgggtttcgggttgggcgag
gcctcggcgttcctattggcaatgaaggacaccgcgaccacgccggcgatggcggggttc
tatattcccccggagttgttgtcgtatgccaccggtgagagcgtcaaagccgagacgatg
ccgtcagagtatcgggatctgctaggcgggctgaatgtagaccaactcaaaaaagtcgcg
gcggccttcatttcacccgacggccactcaatacggtatttgatacaaaccgacctgaat
ccattcagcactgctgccatggaccaaattgacgcgatcacggcggccgctcgaggggcg
caaccaaataccgcactggccgatgccaaggtgtctgtcgtcggattgcccgtcgttctc
aaggacacgcgcgactactccgatcacgacctccgattgatcatcgccatgaccgtctgc
atcgttctgctcatattgatcgttttgctgcgtgcgattgtggcaccgctgtatctgatc
ggctcggttatcgtatcgtacctggcggcgctcggtattggcgttatcgtgttccaattt
ttactcggtcaggaaatgcattggagcattccgggattgaccttcgttatattggtcgcg
gtgggcgcagattacaatatgctgcttatttctaggctgcgtgaagaggccgtcttgggg
gtgcgttccggtgtcatccggaccgtggcctcaacaggtggtgtgatcactgcggcgggt
ttgatcatggctgcctcgatgtacggtctggtattcgccagcttgggtagcgtggttcaa
ggtgcgttcgtcctagggaccgggcttttgctggataccttcttggtgcgtaccgttacc
gtgcccgccattgccgtgttggttgggcaggcgaactggtggttgccgtcaagctggcgg
ccggcaacctggtggccccttggccgacgccgtggccgtgcccaacgaaccaaacgtaag
ccgttgttgcccaaggaagaagaagagcaatcaccgcccgacgacgacgatctgatcggt
ctttggttacacgacgggctcaggctttag

DBGET integrated database retrieval system