KEGG   Mycobacterium tuberculosis UT205: UDA_0545cHelp
Entry
UDA_0545c         CDS       T02142                                 

Gene name
pitA
Definition
(GenBank) pitA
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mtd  Mycobacterium tuberculosis UT205
Brite
KEGG Orthology (KO) [BR:mtd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    UDA_0545c (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCE36085
Position
complement(637658..638911)
Genome map
AA seq 417 aa AA seqDB search
MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVAVALSAVLNLIGAFLS
TAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSSSSHALIGGIVGATIAA
VGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRGVAEKRTERGFRRGQIGS
ASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVIVSCAVAMAAGTYLGGWRI
IRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQVATGSVLGSGVGKPGAEVR
WGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAILGFALLWLTATAIWLRSRRAP
IDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPTPPPNHRAPQFGVTTRNAP
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccttcagttgttccttttgctcattgtcgtcgtgacggcattggcgttcgacttc
accaacgggttccacgacaccggaaacgccatggcgacctcgattgccagcggcgccctg
gcaccgcgggtagcggtagcactttctgccgtgctgaacctgatcggtgcgtttttgtcc
accgccgtggcggccacaatcgccaagggtctgatcgacgcgaatctggtgacgctggag
ttggtgttcgccggcctggtcggcgggatcgtctggaacctgttgacctggttgctgggc
attccgtcgagttcctcacatgcgctgatcggcggcatcgtcggcgccacaattgccgcc
gtcggcctgcgtggggtgatctggagcggagtggtgtccaaggtgatcgtgccggccgtg
gtagccgcgctgctggccacgctggtcggagcagtcggcacctggctggtctaccggacg
acgcgcggggttgccgaaaagcgtacggaacgcggtttccggcgcggccagatcggctcg
gcgtcgctggtctcgctggcgcacggcaccaacgacgcgcagaagacgatgggcgtgatc
ttcctggcgttgatgtcctacggcgcggtcagcacgacggcatcggtgccgccgctgtgg
gtgatcgtgagttgcgccgtggccatggccgccggtacctacctgggtggctggcgcatc
atccgcaccctaggcaaagggctggtcgagatcaaaccaccgcagggtatggccgccgag
tcgtcatcggccgccgtcattctgttgtccgcgcacttcggctatgcgctgtccacaacg
caggtcgcgaccgggtccgtgctgggcagcggcgtcggcaagcccggcgccgaggtgcgc
tggggggtagccggccgcatggtggtcgcgtggctggtgacgctcccgttggccgggctg
gtcggggccttcacctacgggctggtgcatttcatcggtggctaccccggtgcgatcctc
ggtttcgcactgttgtggctgaccgccaccgccatctggctgcggtcgcgcagggcgccg
atcgaccacaccaacgtcaacgccgactgggaaggcaacctgacggccggcctggaagcg
ggtgcgcagccgcttgcggatcagaggccgccggtgcctgcaccgccggctccgactccc
ccaccgaaccaccgagcaccacagttcggcgtcaccacgaggaacgccccgtga

DBGET integrated database retrieval system