KEGG   Mycobacterium tuberculosis UT205: UDA_2679Help
Entry
UDA_2679          CDS       T02142                                 

Gene name
echA15
Definition
(GenBank) echA15
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
mtd00071  Fatty acid degradation
mtd00280  Valine, leucine and isoleucine degradation
mtd00281  Geraniol degradation
mtd00310  Lysine degradation
mtd00360  Phenylalanine metabolism
mtd00362  Benzoate degradation
mtd00380  Tryptophan metabolism
mtd00410  beta-Alanine metabolism
mtd00627  Aminobenzoate degradation
mtd00640  Propanoate metabolism
mtd00650  Butanoate metabolism
mtd00903  Limonene and pinene degradation
mtd00930  Caprolactam degradation
mtd01100  Metabolic pathways
mtd01110  Biosynthesis of secondary metabolites
mtd01120  Microbial metabolism in diverse environments
mtd01130  Biosynthesis of antibiotics
mtd01212  Fatty acid metabolism
Module
mtd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UDA_2679 (echA15)
   00650 Butanoate metabolism
    UDA_2679 (echA15)
  Lipid metabolism
   00071 Fatty acid degradation
    UDA_2679 (echA15)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UDA_2679 (echA15)
   00310 Lysine degradation
    UDA_2679 (echA15)
   00360 Phenylalanine metabolism
    UDA_2679 (echA15)
   00380 Tryptophan metabolism
    UDA_2679 (echA15)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UDA_2679 (echA15)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    UDA_2679 (echA15)
   00281 Geraniol degradation
    UDA_2679 (echA15)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UDA_2679 (echA15)
   00627 Aminobenzoate degradation
    UDA_2679 (echA15)
   00930 Caprolactam degradation
    UDA_2679 (echA15)
Enzymes [BR:mtd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     UDA_2679 (echA15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCE38140
Position
3000142..3000972
Genome map
AA seq 276 aa AA seqDB search
MPVTYDDFPSLRCEIHDQPGHEGVLELVLDSPGLNSVGPHMHRDLADIWPVIDRDPAVRV
VLVRGEGKAFSSGGSFDLIAETIGDYQGRLRIMREARDLVLNLVNFDKPVVSAIRGPAVG
AGLVVALLADISVAGRAAKIIDGHTKLGVAAGDHAAICWPLLVGMAKAKYYLLTCEPLSG
EEAERIGLVSICVDDDDVLPTATRLAERLAAGAQNAIRWTKRSLNHWYRMFGPAFETSLG
LEFIGFGGPDVREGLAAHREKRPARFGADPDPGAGS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagttacctacgacgacttccccagcctgcgctgcgaaatccacgaccaacctggt
cacgaaggcgtgctggagctggtgctggactcccccgggctgaactcggtcgggccgcac
atgcaccgcgaccttgccgacatctggccggtgatcgatcgcgacccggccgtgcgcgtg
gtcttggtccgcggtgaaggcaaggccttttcctccggcggcagtttcgacctgatcgcc
gaaaccatcggcgactaccagggccggctgcgcatcatgcgcgaggcccgcgacctggtg
ctcaacctggtcaacttcgacaagccggtggtgtcggcgattcggggcccggccgtcggt
gcgggtctggttgtcgcgctgctcgccgacatttcggtggcgggccgcgccgcgaagatc
atcgatgggcacaccaaactcggggtcgccgcgggggatcacgcggcgatctgctggccc
ctgctggtcggcatggccaaggccaagtactacctgctgacctgcgagccgctgtccggg
gaggaggccgaacgcatcggtctggtctccatctgcgtcgacgacgacgatgtgctcccc
accgcaacacgcctggcggagcggctcgccgctggcgcgcaaaacgccatccgctggacc
aaacgcagcctcaatcactggtatcgcatgttcggtcccgccttcgaaacgtcgctcggg
ctggagttcatcgggttcggtggtcccgacgtccgggaaggcctggccgcgcaccgcgaa
aagcgccccgcgcggttcggcgccgaccccgatcccggcgccggcagctga

DBGET integrated database retrieval system