KEGG   Mycobacterium tuberculosis UT205: UDA_3535cHelp
Entry
UDA_3535c         CDS       T02142                                 

Definition
(GenBank) unnamed protein product
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
mtd00360  Phenylalanine metabolism
mtd00362  Benzoate degradation
mtd00620  Pyruvate metabolism
mtd00621  Dioxin degradation
mtd00622  Xylene degradation
mtd00650  Butanoate metabolism
mtd01100  Metabolic pathways
mtd01120  Microbial metabolism in diverse environments
mtd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UDA_3535c
   00650 Butanoate metabolism
    UDA_3535c
  Amino acid metabolism
   00360 Phenylalanine metabolism
    UDA_3535c
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UDA_3535c
   00622 Xylene degradation
    UDA_3535c
   00621 Dioxin degradation
    UDA_3535c
Enzymes [BR:mtd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     UDA_3535c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCE38957
Structure
PDB: 

Position
complement(3979939..3980850)
Genome map
AA seq 303 aa AA seqDB search
MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVD
WLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQT
IGGAARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLL
NEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVG
GAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaggcaaaagtggcgattgtcgggtcgggaaatatcagcaccgatctgctg
tacaagctgctgcgatcggagtggctggagccgcgctggatggtgggcatcgacccggag
agcgatggcctggcgcgcgcggccaagctgggtttggagaccacccacgagggggtggac
tggctgctggcgcagcccgataaacccgacctggtgttcgaggcaaccagtgcctacgtg
caccgggacgcggcgcccaagtacgccgaggccgggatccgggccatcgacctgacgccg
gcggcggtgggtccggcggtgatcccgccggcgaacctgcgcgagcacctggacgcgccg
aacgtcaacatgatcacctgcgggggacaggcgaccattccgatcgtgtacgcggtgtct
cggatcgtggaggtgccctacgccgagatcgtggcgtcggtggcttccgtttcagcggga
ccgggcacgcgcgccaacatcgacgagttcaccaagaccaccgcccgtggggtccagacc
atcggcggggccgcccgcggcaaggcgatcatcatcttgaatcccgccgacccgccgatg
atcatgcgcgacaccatcttttgcgccatccccaccgacgccgaccgcgaagcgatcgcc
gcctccatccacgacgtcgtcaaagaggtgcagacctacgtgcctggataccggctgctc
aacgaaccgcagttcgacgagccgtcgatcaactcgggcgggcaggcgctggtcaccacg
ttcgtcgaggttgagggcgccggggattacctgccgccctatgcgggcaacctggacatc
atgaccgcggcggccaccaaggtgggcgaggagatcgccaaggagacgctggttgtagga
ggagcgcgatga

DBGET integrated database retrieval system