KEGG   Mycobacterium tuberculosis UT205: UDA_3546Help
Entry
UDA_3546          CDS       T02142                                 

Gene name
fadA5
Definition
(GenBank) fadA5
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
mtd00071  Fatty acid degradation
mtd00072  Synthesis and degradation of ketone bodies
mtd00280  Valine, leucine and isoleucine degradation
mtd00310  Lysine degradation
mtd00362  Benzoate degradation
mtd00380  Tryptophan metabolism
mtd00620  Pyruvate metabolism
mtd00630  Glyoxylate and dicarboxylate metabolism
mtd00640  Propanoate metabolism
mtd00650  Butanoate metabolism
mtd00900  Terpenoid backbone biosynthesis
mtd01100  Metabolic pathways
mtd01110  Biosynthesis of secondary metabolites
mtd01120  Microbial metabolism in diverse environments
mtd01130  Biosynthesis of antibiotics
mtd01200  Carbon metabolism
mtd01212  Fatty acid metabolism
mtd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UDA_3546 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    UDA_3546 (fadA5)
   00640 Propanoate metabolism
    UDA_3546 (fadA5)
   00650 Butanoate metabolism
    UDA_3546 (fadA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UDA_3546 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    UDA_3546 (fadA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UDA_3546 (fadA5)
   00310 Lysine degradation
    UDA_3546 (fadA5)
   00380 Tryptophan metabolism
    UDA_3546 (fadA5)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UDA_3546 (fadA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UDA_3546 (fadA5)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UDA_3546 (fadA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtd04147]
    UDA_3546 (fadA5)
Enzymes [BR:mtd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UDA_3546 (fadA5)
Exosome [BR:mtd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UDA_3546 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CCE38968
Structure
PDB: 

Position
3991907..3993082
Genome map
AA seq 391 aa AA seqDB search
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggttacccggtcatcgttgaagccacccgcagccccatcggcaaacgcaacggatgg
ctgtcggggctgcatgccaccgagttgttgggcgcggtgcaaaaggcggtggtcgacaag
gccggcatccagtccggccttcacgccggtgacgtcgaacaggtcatcggcggttgcgtg
acccagttcggggagcaatccaacaacatcagccgggtggcctggctgacggccggtttg
cccgaacacgtcggcgccaccaccgtcgactgccagtgcggcagcggccagcaggccaac
catctgattgccgggttgatcgcggccggtgccatcgatgtcggcatcgcctgcggcatc
gaggcgatgagccgggtcgggctgggcgccaacgccgggccggaccgctcgctgatccgc
gcgcagtcatgggatatcgacctgccgaaccagttcgaggccgccgagcggatcgccaag
cggcgcggcatcacccgcgaggacgtggatgtcttcgggctcgagtcgcagcgacgcgcg
cagcgggcctgggcggagggccgctttgaccgcgagatctcgccgatccaggcgccggtg
ctcgacgagcagaatcagcccaccggcgagcggcgcctggtctttcgcgaccagggcctg
cgcgagaccacgatggcggggctaggcgagctgaaaccggtgctcgagggcggcatccac
accgcgggcacgtcgtcgcagatctccgacggcgcggcagccgtgttgtggatggacgaa
gccgtggcacgtgcgcacggcctgaccccgcgggcccggatcgtcgcccaggcactcgtc
ggcgccgagccctactaccacctggacggcccggtgcagtccaccgcgaaggtgctggag
aaggccggcatgaagatcggcgacatcgacatcgtcgagatcaacgaggcgttcgcgtcc
gtggtgctgtcctgggcgcgggtgcacgagcccgacatggaccgggtcaacgtcaacggc
ggggcgatcgcgctggggcatccggtgggctgcaccggcagccggctgatcaccaccgcc
ctgcacgagctcgagcgcaccgaccagagcctcgcgctgatcaccatgtgcgccggcggg
gccctgtccaccggcaccatcatcgagcggatttaa

DBGET integrated database retrieval system