KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0103Help
Entry
CCDC5079_0103     CDS       T01991                                 

Definition
(GenBank) putative oxalyl-CoA decarboxylase
  KO
K01577  oxalyl-CoA decarboxylase [EC:4.1.1.8]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00630  Glyoxylate and dicarboxylate metabolism
mte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CCDC5079_0103
Enzymes [BR:mte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.8  oxalyl-CoA decarboxylase
     CCDC5079_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEJ45293
Position
complement(139749..141467)
Genome map
AA seq 572 aa AA seqDB search
MLTDGCHLVVDALKANDVDTIYGVVGIPITDLARAAQASGIRYIGFRHEASAGNAAAAAG
FLTARPGVCLTTSGPGFLNGLPALANATTNCFPMIQISGSSSRPMVDLQRGDYQDLDQLN
AARPFVKAAYRIGQVQDIGRGVARAIRTATSGRPGGVYLDIPGDVLGQAVEASAASGAIW
RPVDPAPRLLPAPEAIDRALDVLAQAQRPLLVLGKGAAYAQADNVIREFVEHTGIPFLPM
SMAKGLLPDSHPQSAAAARSLAMARADVVLLVGARLNWLLGNGESPQWSADAKFIQVDIE
ASEFDSNRPIVAPLTGDIGSVMSALLEAAADRSSVASAAWTGELADRKARNSAKMRRRLA
DDHHPMRFYNALGAIRSVLQRNPDVYVVNEGANALDLARNIIDMHLPRHRLDSGTWGVMG
IGMGYAIAAAVETGRPVVAIEGDSAFGFSGMEFETICRYRLPVTVVILNNGGVYRGDEAT
IFRSAAPVWRHDPAPTVLNAHARHELIAEAFGGKGYHVSTPTELESALTDALASNGPSLI
DCELDPADGVESGHLAKLNTTSAATPAISGDG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccgacggctgccacctggtggtggacgccctcaaagccaacgacgtcgacacc
atctacggcgttgtcggcatcccgatcaccgacctggctcgcgccgcccaagcctcgggg
atccgctatatcggtttccgccacgaagcatcagcgggcaatgcggcggccgccgcgggg
ttcctcaccgcacggcccggcgtgtgtctgacgacgtccggccccggctttctcaacggc
ctgcccgcgctggcgaacgccaccacgaactgcttcccgatgatccagatctccggatcg
agcagccggccgatggtcgacctgcagcgcggcgactatcaggacctcgaccagctcaac
gccgctcgaccgttcgtgaaggcggcgtatcggatcggccaagtccaggacatcgggcgc
ggcgtcgcgcgcgccattcgcaccgcgacctccgggcggcccggcggtgtatacctcgat
atccccggcgatgtgctgggccaggccgttgaggcatcggctgcttccggcgccatttgg
cggccggtggacccggctccccgactactgccggcaccggaggcgattgatcgcgcgctg
gacgtgctcgcccaagcgcagcgaccgctgctcgtgctcggcaagggcgcggcatatgcg
caggccgacaacgttattcgggagtttgtggagcacaccggcattcccttcctgccgatg
tcgatggccaaggggctgctgcccgactcacacccgcagtcggcggctgcggctcgttcg
ctggcgatggcccgcgccgacgtggtgctgctggttggcgctcggctgaattggctacta
ggcaacggagagtcgccgcaatggtcggccgatgccaagttcatccaggtcgatatcgag
gcgtcggagtttgacagcaaccggccgatcgtggcaccgctgaccggcgacatcggctcg
gtaatgtcggcgctcctcgaagctgcggccgatcgttcgagcgtggcctcggcggcgtgg
accggcgagctcgccgaccgcaaggcccgcaacagtgccaagatgcgtcggcggttggcc
gacgatcatcatccgatgcggttctacaacgcgcttggtgccattaggtctgtgctgcaa
cgcaacccggatgtctatgtggtcaacgaaggcgccaacgcgctggacctcgcccgcaac
atcatcgacatgcacctaccgcggcaccggctcgacagcggaacctggggcgtgatgggc
atcggcatgggctacgccatcgcggccgccgtcgagaccgggcgacctgtcgtggcgatc
gagggcgacagcgcatttggcttcagcggcatggagttcgagaccatctgccgataccga
ctcccggtcaccgtcgtcatcctcaacaacggcggcgtctaccgcggcgacgaggcaacg
atctttaggtcggccgccccggtgtggcgacacgacccagcgcccaccgtgctgaacgct
catgcacgtcacgaactgatcgcagaggcgttcggcggcaaaggatatcacgtaagcacc
ccaaccgaactggagtcggcgctgaccgatgcactggcatcgaacggaccgtcactcatc
gactgcgaactcgaccctgcagacggggtggagagcggccacctggcgaagctgaacact
accagcgcagcgacgcccgcgatcagcggcgacgggtga

DBGET integrated database retrieval system