KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0458Help
Entry
CCDC5079_0458     CDS       T01991                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00010  Glycolysis / Gluconeogenesis
mte00260  Glycine, serine and threonine metabolism
mte00680  Methane metabolism
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01200  Carbon metabolism
mte01230  Biosynthesis of amino acids
Module
mte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mte_M00002  Glycolysis, core module involving three-carbon compounds
mte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5079_0458
  Energy metabolism
   00680 Methane metabolism
    CCDC5079_0458
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5079_0458
Enzymes [BR:mte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CCDC5079_0458
Membrane trafficking [BR:mte04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CCDC5079_0458
Exosome [BR:mte04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CCDC5079_0458
  Exosomal proteins of melanoma cells
   CCDC5079_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEJ45648
Structure
PDB: 

Position
576352..576762
Genome map
AA seq 136 aa AA seqDB search
MAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLR
VGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDP
EAAAAGAAAVAGQGRG
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcggcgcagctatgacacgccgccgccgccgatcgagcggggcagtcagttc
agccaggacgccgaccctcgttacgccgacatcggcggtggcccgctcaccgaatgtctg
gctgacgtggtcgcccggtttttgccatatttcaccgacgtcatcgttggcgacttgcgg
gtcggcaagacggtgctgatcgttgcccacggcaactcgttgcgcgcgctggtcaagcac
ctggaccagatgtctgacgacgaaatcgtcggactgaacatcccgaccggaattccgctg
cgctacgacctggattccgcgatgaggccgctggtgcgcggtggtacgtatctggacccg
gaggcggcagccgccggcgccgccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system