KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0480Help
Entry
CCDC5079_0480     CDS       T01991                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00860  Porphyrin and chlorophyll metabolism
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
Module
mte_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCDC5079_0480
Enzymes [BR:mte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CCDC5079_0480
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CCDC5079_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AEJ45670
Position
600373..602079
Genome map
AA seq 568 aa AA seqDB search
MTIMTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVVALIGTDL
PPVSGPAPAEPVAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGDPADVAKTLTAEAR
SGVDVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVPTYAGLPLGSSHTVA
DVRIDPENTDWDALAAAPGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQR
SVETTLQGLTDPAVLGATDPACSANGRDSQAGPLIVTIGKTVTSRAKLNWWESRALYGWT
VLVPRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWIVFTS
TNAVRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPSGEQSSLGLLDD
FPPYDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATTREMIK
TGGFDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPDTAAIGP
LVDALAEHAARLRAEGALPPPRKKSRRR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcatgacgcgagggcgtaagccgagaccgggccgcatcgttttcgtgggctcc
ggtccgggcgaccccggcttgcttacgacacgggctgccgcggtgctggccaacgccgcg
ctggtgttcaccgatcccgacgtaccggagccggtggtggcgctgatcggcacggatctg
ccccccgtgtccggcccggcgcccgccgagccggttgccgggaacggcgatgcggccggc
ggaggaagtgcgcaggaacacggccgggccgcgtccgcggtagtctccggtggtcctgac
atccgcccggcgctgggcgatcccgccgatgtggccaagacgctgaccgccgaggcccgt
tcgggtgtcgacgtggtgcggctggtggcgggcgatccgctcacggtggatgcggtaatc
agcgaggtgaacgccgtcgcacgcacccacctgcacatcgaaatcgtgcccggcctggcc
gccagcagcgcggtcccgacctatgccgggttgccgctgggttcgtcgcacaccgtcgcc
gacgtgcgtatcgaccccgaaaacaccgactgggacgcgctggctgccgcacccgggccg
ctgatcctgcaggccaccgcatcgcatctagccgaatcggcccgcagcctgatcgatcac
cagctggccgagtccactccgtgcgtggtgaccgcacacggcaccacctgtcagcagcgt
tcggtcgagaccacacttcagggattgaccgacccggccgtcctgggcgctaccgacccc
gcgtgctccgcaaacgggagggactcccaggccggaccgctgatagtgaccatcggcaag
acggtgaccagtcgggcaaagctgaactggtgggagagccgcgccctctacggctggacg
gtgttggtgccgcgcaccaaggaccaggccggcgagatgagcgagcggctcacgtcgtac
ggcgcgctgccggtggaggtgccgaccatcgccgtcgagccgccgcgcagccccgcgcag
atggagcgcgccgtcaagggcctggtcgatggccgattccagtggatcgtgttcacctcc
accaacgcggtgcgtgcggtgtgggagaagttcggcgagttcggtctggatgcccgcgcg
ttctccggggtgaagatcgcctgtgtcggcgagtcgacggccgaccgggtgcgcgccttc
ggaatcagtcccgagctggtgccctccggggagcagtcctcgcttggcttgctagacgac
ttcccgccctacgacagcgttttcgacccggtgaaccgggttttgctgccgcgcgccgac
atcgccaccgaaacgctggccgagggactgcgagagcgtggctgggagatcgaggacgtc
accgcctaccggaccgtgcgggccgcgccgccgccggccactacccgggaaatgatcaag
acgggcgggtttgacgcggtatgtttcacctccagctcgacggtgcgaaacctggtcggc
atcgccggcaagccgcacgcgcggacgatcatcgcctgcatagggccaaagaccgccgag
accgcagccgagttcggcttgcgggtcgatgtccagccggacaccgccgccatcggcccg
ctggtcgatgcgctggccgagcatgccgcccggttgcgcgctgagggtgcgctgcccccg
ccgcgcaagaagagccgcaggcgctag

DBGET integrated database retrieval system