KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0794Help
Entry
CCDC5079_0794     CDS       T01991                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00072  Synthesis and degradation of ketone bodies
mte00280  Valine, leucine and isoleucine degradation
mte00310  Lysine degradation
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00620  Pyruvate metabolism
mte00630  Glyoxylate and dicarboxylate metabolism
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00900  Terpenoid backbone biosynthesis
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01200  Carbon metabolism
mte01212  Fatty acid metabolism
mte02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCDC5079_0794
   00630 Glyoxylate and dicarboxylate metabolism
    CCDC5079_0794
   00640 Propanoate metabolism
    CCDC5079_0794
   00650 Butanoate metabolism
    CCDC5079_0794
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0794
   00072 Synthesis and degradation of ketone bodies
    CCDC5079_0794
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0794
   00310 Lysine degradation
    CCDC5079_0794
   00380 Tryptophan metabolism
    CCDC5079_0794
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCDC5079_0794
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0794
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CCDC5079_0794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mte04147]
    CCDC5079_0794
Enzymes [BR:mte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCDC5079_0794
Exosome [BR:mte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCDC5079_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEJ45984
Structure
PDB: 

Position
951261..952499
Genome map
AA seq 412 aa AA seqDB search
MEFVEQEIDMSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLI
SDVILGCVSPVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWD
DLVLAGGVESMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYA
LRSQQKAAEAWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAAL
GGFDDVALQKYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATAT
SGADPVIMLTGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVN
GGAIAMGHPLGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtggaatttgtggaacaggaaatcgacatgtccgaagaagccttcatctacgaggccatc
cgcaccccgcgcggcaaacaaaagaacggatcgttgcacgaagtcaagccattgagcctg
gtcgtcggcctgatcgacgagctgcgcaagcgccatcccgacctcgacgagaacctgatc
agcgacgtcatcttgggctgcgtctcaccggtgggcgaccagggcggcgacatcgcccgc
gccgcagtgctggcatcgggcatgccggtcacctccggcggtgtgcagctcaaccggttc
tgcgcgtccggcctggaggccgtcaacaccgccgcgcagaaggtgcgttcgggctgggat
gacctggtgctggccggcggcgtggagtcgatgagccgggtgccgatgggctccgacggc
ggcgctatgggcctggacccggcgaccaactacgacgtcatgttcgtcccgcagggcatc
ggcgccgacctgatcgccaccatcgagggcttctcccgcgaagacgtcgacgcctacgcg
ctacgcagccagcaaaaggccgccgaggcgtggtcgggcggctacttcgccaagtcggtg
gtgccggtgcgcgaccagaacggcctgctgatcctcgatcatgacgaacacatgcggccg
gacaccaccaaggagggtctggccaagctgaagccggccttcgaaggcctggccgcgctg
ggcggtttcgacgacgtggcgctgcagaagtaccactgggtggaaaagatcaaccacgta
cacaccggcggcaacagctcggggatcgtcgacggtgccgcgctggtgatgatcggttcc
gcggccgccggcaagttgcagggcctgactccgcgggcgcgcatcgtcgccaccgccacc
agcggcgccgacccggtgatcatgctcaccggccccaccccggccacccgcaaggtgctc
gaccgcgccgggctgaccgtcgacgacatcgacctgttcgagctcaacgaggcgttcgcg
tcggtggtgctgaagttccagaaggacctcaacattcccgacgagaagctcaacgtcaac
ggtggcgccatcgcgatgggccacccgctgggtgccaccggcgcgatgatcctgggcacc
atggtcgacgaactggagcgccgcaacgcccgacgtgcactcatcacgctgtgcatcggg
ggcggcatgggtgtcgcgacgatcatcgagagggtttaa

DBGET integrated database retrieval system