KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0817Help
Entry
CCDC5079_0817     CDS       T01991                                 

Definition
(GenBank) NADPH:adrenodoxin oxidoreductase FprB
  KO
K00528  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09112 Not included in regular maps
   09113 Global maps only
    CCDC5079_0817
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCDC5079_0817
Enzymes [BR:mte01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     CCDC5079_0817
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     CCDC5079_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer4 Fer4_6 Fer4_7 Fer4_10 NAD_binding_8 Fer4_16 FAD_binding_3 Fer4_2 Pyr_redox Fer4_9 Fer4_21 Fer4_4 NAD_binding_7 Fer4_8 NAD_binding_9 HI0933_like UPF0146 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEJ46007
Position
980095..981762
Genome map
AA seq 555 aa AA seqDB search
MNCIHPTPDEPGFATSEMLYIDPVACVDCGACVTACPVSAIAPNTRLDFEQLPFVEINAS
YYPKRPAGVKLAPTSKLAPVTPAAEVRVRRQPLTVAVVGSGPAAMYAADELLVQQGVQVN
VFEKLPTPYGLVRSGVAPDHQNTKRVTRLFDRIAGHRRFRFYLNVEIGKHLGHAELLAHH
HAVLYAVGAPDDRRLTIDGMGLPGTGTATELVAWLNGHPDFNDLPVDLSHERVVIIGNGN
VALDVARVLAADPHELAATDIADHALSALRNSAVREVVVAARRGPAHSAFTLPELIGLTA
GADVVLDPGDHQRVLDDLAIVADPLTRNKLEILSTLGDGSAPARRVGRPRIRLAYRLTPR
RVLGQRRAGGVQFSVTGTDELRQLDAGLVLTSIGYRGKPIPDLPFDEQAALVPNDGGRVI
DPGTGEPVPGAYVAGWIKRGPTGFIGTNKSCSMQTVQALVADFNDGRLTDPVATPTALDQ
LVQARQPQAIGCAGWRAIDAAEIARGSADGRVRNKFTDVAEMLAAATSAPKEPLRRRVLA
RLRDLGQPIVLTVPL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgaactgcatccacccgacgccggacgagccgggcttcgcgacctcggaaatgctctat
atcgatccggtggcctgcgtggactgtggtgcctgcgtaaccgcctgcccggtcagcgcg
atcgcgccgaacacccggttggacttcgagcagctgccgttcgtcgaaatcaatgcgtcg
tattacccgaagcggcccgccggcgtgaagctagcgccgacgtcgaagctggctccggtg
actccggccgccgaggtgcgtgtgcgccggcagccgctgacggtagccgtcgtcgggtcc
gggcccgcggcgatgtatgccgccgatgagctgctggtccagcagggagtgcaggtcaac
gtctttgagaagctgccgacaccctacgggctggtgcgctccggggtggcgccggatcac
cagaacaccaagcgggtcacgcgactatttgaccggatcgccggtcatcgccgcttccgg
ttctatctcaacgtcgagatcggcaagcatctaggccatgccgagctattggcccaccat
cacgccgtgctgtacgcggtcggagcgcccgacgaccgccggctgacgattgacgggatg
ggactgccgggcaccggtaccgccacggagctggtcgcgtggctcaacggacatcccgac
ttcaacgatctgccagtcgatctcagtcacgaacgcgtggtgatcatcggcaacgggaat
gtcgcgctcgacgtggcgcgcgtgcttgcggccgatccgcacgagctggccgccaccgac
atcgccgaccacgcgttgtccgcgttacgcaactcggcggtccgtgaggtggtggtcgcc
gcccgccgcggtcctgcccattcggcgttcaccctgcccgagctgatcgggctcacggcc
ggagccgacgtcgtgcttgacccgggagatcatcagcgagtactcgatgatctggcaatc
gttgccgatccgttgaccaggaacaagctggagatcttgagcacgctgggggacgggtcg
gcgcctgcgcgacgagtcgggcgcccgcggatccggctggcctatcggctcacgccgcgg
cgcgtcctcggccagcggcgggccggcggagttcagttctcggtcaccggaaccgacgag
ctgcgccaactggatgctggcctggtgctgacgtcgattggctaccgcggcaagccgatt
cccgacctgccgttcgacgagcaggccgcgctcgtgcccaacgatggtggacgggtcatc
gacccgggcaccggcgagccggtgcccggcgcatacgtcgcgggttggatcaagcgcggg
cccaccgggttcatcggcacgaacaagtcctgctctatgcagaccgttcaggcgttggtg
gccgacttcaacgacggccggctgaccgatccggtggctacaccgacggcgctggatcag
ctggtgcaggcccgccagccccaagccatcggctgtgcgggatggcgggccatcgacgcg
gccgagattgcgcgcggcagcgccgacggccgggtccgcaacaagttcaccgacgtcgcc
gagatgctcgcggcagcaaccagcgcgcctaaggaaccgcttcggcggcgcgtgctggcc
cggctgcgtgacctggggcagccgatcgtgctaaccgtccccttgtga

DBGET integrated database retrieval system