KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1279Help
Entry
CCDC5079_1279     CDS       T01991                                 

Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00240  Pyrimidine metabolism
mte00250  Alanine, aspartate and glutamate metabolism
mte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CCDC5079_1279
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCDC5079_1279
Enzymes [BR:mte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CCDC5079_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEJ46469
Position
1552450..1553409
Genome map
AA seq 319 aa AA seqDB search
MTPRHLLTAADLSRDDATAILDDADRFAQALVGRDIKKLPTLRGRTVVTMFYENSTRTRV
SFEVAGKWMSADVINVSAAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLAQW
TGAHNDGPAVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRIVIVGDILHSRVARSNVM
LLDTLGAEVVLVAPPTLLPVGVTGWPATVSHDFDAELPAADAVLMLRVQAERMNGGFFPS
VREYSVRYGLTERRQAMLPGHAVVLHPGPMVRGMEITSSVADSSQSAVLQQVSNGVQVRM
AVLFHVLVGAQDAGKEGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaggcacctgctgaccgccgccgacctcagccgcgacgacgccaccgccatc
ctcgacgacgccgaccggtttgcgcaggcgctggtcggtcgcgacatcaagaagctgccg
acgctgcggggccggaccgtcgtcacgatgttctatgagaactccacccgcacccgggtg
tcgttcgaggtagcgggtaagtggatgagcgccgacgtgatcaacgtcagcgctgccgga
tcttcggtaggcaagggtgagtcgctgcgggataccgcgctgaccctgcgcgcggccggg
gctgacgcgctgatcatccgccatcccgcgtccggcgccgcccatctgctggcgcagtgg
accggcgcccacaacgatgggccggcggtgatcaacgccggtgacggcactcatgaacac
cccacgcaggcgctgcttgatgcgctgaccatccgtcagcgcctcggcggcatcgaaggc
cggcgcatcgtgatcgtcggcgacatcctgcacagccgggtcgcccgctccaacgtcatg
ctgctggacaccctgggcgccgaggtggtgctggtggcgccacccacattgctaccggtc
ggggtgaccggctggccggccaccgtctcccacgacttcgatgccgagctgcccgccgcc
gacgcggtattgatgctgcgggtacaggccgagcggatgaacggcggttttttcccgtcc
gtacgggagtactcggtccgctacgggctaaccgagcggcgccaggcgatgcttcccggc
cacgccgtggtgttgcacccgggaccgatggtgcgtggcatggagatcacatcttcggtc
gcggactcgtcgcaatcggctgtgctgcaacaggtttccaatggagtccaggtgcggatg
gcggtgctgttccatgtgctggtgggagcgcaggatgccggtaaagagggtgcggcgtga

DBGET integrated database retrieval system