KEGG   Mycolicibacter terrae: 4434518_00464Help
Entry
4434518_00464     CDS       T05465                                 

Gene name
ramA
Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mter  Mycolicibacter terrae
Brite
KEGG Orthology (KO) [BR:mter00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4434518_00464 (ramA)
Enzymes [BR:mter01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     4434518_00464 (ramA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase TetR_N
Motif
Other DBs
NCBI-ProteinID: SNV55813
UniProt: A0A1X2DZZ4
Position
1:complement(489926..490750)
Genome map
AA seq 274 aa AA seqDB search
MRIACAQILSGTDPAANLELVAEHTERAAAQGARLVVFPEATMCRFGVPLGPVAEPLDGP
WATRVRDIAARAGVTVIAGMFVPAGDGRVSNTLLATGPGTEAHYHKIHLYDAFGFTESRT
VAPGSDPVVIDVDGVGVGLSTCYDIRFPTLYTELADRGAQLIAVCASWGAGPDKLRQWEL
LACARALDSTSYIAAVGQAYPGAGDPASSSGAPTGVGHSLVASPWGEVVVSAGPEPQLLV
CDVDLDAVGSARRTLAVLSNRADFLQVGKAESRG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcggatagcgtgtgcgcagatcctcagcgggaccgacccggccgccaacctggagttg
gtcgccgaacacaccgagcgcgccgccgcccagggcgcgcgcctggtggttttcccggag
gccacgatgtgccggttcggggtgccgctgggcccggtcgccgagccgctcgacgggccg
tgggccacccgggtgcgcgacatcgccgcccgggccggggtgaccgtcatcgcggggatg
ttcgtcccggccggcgacggacgggtcagcaacaccctgctggcgaccggaccgggaacc
gaagcgcactatcacaagatccacctctacgacgcgttcggattcaccgaatcacgcacc
gtcgcaccgggatccgatcccgtggtgatcgacgtcgacggcgtcggcgtcggcctgtcc
acttgctatgacatccggttcccgacgctgtacaccgagttggccgatcgcggtgcccag
ctgatcgcggtgtgcgcctcgtggggcgccgggccggacaaactgcggcagtgggaactg
ctggcctgcgcccgggcgctggattcgaccagctacatcgccgccgtcgggcaggcctac
cccggcgccggcgacccggcgagttcgtcgggcgcgccgaccggtgtgggccacagcctg
gtcgcctcgccgtggggtgaggtggtggtgtcggccggcccggaaccgcagctcctggtc
tgcgacgtcgacctcgacgcggtcggcagcgcccgccgaaccctggccgtgttgagcaat
cgcgcggattttcttcaggtcggtaaggcagaatcgcgcgggtga

DBGET integrated database retrieval system