KEGG   Mycolicibacter terrae: 4434518_00804Help
Entry
4434518_00804     CDS       T05465                                 

Gene name
hdl_IVa
Definition
(GenBank) L-2-haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mter  Mycolicibacter terrae
Pathway
mter00361  Chlorocyclohexane and chlorobenzene degradation
mter00625  Chloroalkane and chloroalkene degradation
mter01100  Metabolic pathways
mter01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    4434518_00804 (hdl_IVa)
   00361 Chlorocyclohexane and chlorobenzene degradation
    4434518_00804 (hdl_IVa)
Enzymes [BR:mter01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     4434518_00804 (hdl_IVa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: SNV59450
UniProt: A0A1X2ED76
Position
1:846564..847262
Genome map
AA seq 232 aa AA seqDB search
MAGAARPAVLVFDVNETLIDIEALEPLFARLFGRPGVLREWFGQLVIYSMTVTLADCYTD
FFSLGQSALRMLAEIHGVELADDDVTAVADAMATMPAHPDVTEGLSRLRDNGYRLVALTN
SPAYPGRPTALENAGLDGYFERRFSVDELRVFKPATMLYQHTAHELGVRPSACMMVAAHA
WDTIGAQAAGFSGALITRPGNAPLRADGIYQPDIVAGDLVDLARQLAQLFEK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcagcgcggcccgcggtgctggtgttcgacgtcaatgagacgctcatcgat
atcgaagcgttagagccgctgttcgcaaggcttttcggccgtccaggggtgcttcgggag
tggttcggccaacttgtcatctactcgatgaccgtcaccctggcggactgttacacggat
ttcttctccctcgggcagtccgcgttgcgaatgctcgccgagatacacggagtcgagttg
gccgatgacgacgtgacggccgtggccgacgcgatggccaccatgccggcacatcccgac
gtcactgaagggctgtcgcgactgcgcgacaacggctaccggttggtggcgctgacgaac
tcgccggcctaccccggtcgcccgacggcattggaaaacgcgggtctggacggctacttc
gagcgccggttcagtgtcgacgagctgcgggtcttcaagcccgcgacgatgctgtaccag
cacaccgcgcacgaactgggtgtgcggccttcggcctgcatgatggtcgccgcgcacgcc
tgggacaccatcggcgcgcaagccgccggattcagcggcgccctcatcactcgtcccggt
aacgcgccgttgcgggcggacggcatctaccaacccgacatcgtcgcgggcgacctcgtc
gatctagctcggcaactggcgcagcttttcgaaaaatag

DBGET integrated database retrieval system